KEGG   Hyphomonas neptunium: HNE_1147Help
Entry
HNE_1147          CDS       T00397                                 

Gene name
galU
Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hne  Hyphomonas neptunium
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HNE_1147 (galU)
   00052 Galactose metabolism
    HNE_1147 (galU)
   00500 Starch and sucrose metabolism
    HNE_1147 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HNE_1147 (galU)
Enzymes [BR:hne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HNE_1147 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1158315..1159187
Genome map
AA seq 290 aa AA seqDB search
MRVRKAVLPVAGLGTRVLPATKAIPKELLPVVDRPVIQYVVDEAIEAGIEHIVFVTGRSK
GAIEDYFDHAYELEAQLKLKNKTDILKQVEASRLPAGSSSFVRQQAPLGLGHAVWCARDV
IGNEPFAVLLPDVIVKGKPSSLKQMVDAYDKVGGNIVAVDPVPEERVSSYGVIAPVSRDG
RLIKMSGMVEKPPRDSAPSNLAITGRYILQPEIFGLLEKQGAGAGGEIQLTDSMAKLMEL
QDFYAYEFEGSVHDCGNKTGYFDAVLAHALDNPDTAEFARALVKKTAQGL
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcagaaaagctgttcttcccgtggccgggctcggcacgcgtgtgctgcctgcc
accaaggcgattccgaaggaattgctgcccgtggtggaccgtccggtgatccagtatgtg
gtcgatgaggccatcgaggccgggatcgagcacatcgttttcgtcactggccgcagcaaa
ggcgccatcgaagactatttcgaccatgcctatgagctggaagcccagctgaagctcaag
aacaagaccgatattctcaaacaggtcgaggcctcgcgccttccggccggctcatccagc
tttgtacgccagcaggcgccgctgggcctgggccatgcggtatggtgtgcgcgcgatgtg
atcggcaacgagccgtttgccgtgctgcttcccgatgtgatcgtgaagggtaagccttcg
agcctgaagcagatggtcgacgcctatgacaaggtgggcggcaatatcgtcgccgttgac
cctgtgcctgaagagcgcgtctcttcctatggggtgatcgcgccggtttcgcgtgatggc
cgcctgatcaagatgtccggcatggtggaaaagccgccgcgtgacagcgcgccgtctaac
cttgccatcaccgggcgctacatcctccagccggaaatctttggtcttctggaaaaacag
ggcgcgggcgcaggcggggaaatccagctgaccgactcgatggccaagctgatggagctt
caggacttctacgcctacgaatttgaaggctctgtccatgattgcggcaacaagaccggc
tatttcgatgccgtgctggcccatgcgctggataatccggatacggcggagtttgcccgc
gcactggtgaagaagaccgcgcaggggctttga

DBGET integrated database retrieval system