KEGG   Hyphomonas neptunium: HNE_1238Help
Entry
HNE_1238          CDS       T00397                                 

Gene name
aceB
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
hne  Hyphomonas neptunium
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HNE_1238 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HNE_1238 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    HNE_1238 (aceB)
Enzymes [BR:hne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     HNE_1238 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1258427..1260064
Genome map
AA seq 545 aa AA seqDB search
MSTTATLEHPSATRAKIEVKGKAAGVERVLTPQALAFIEALERRFGARRRELLSLRKERQ
ARFDAGELPDFLPETKSIRNGHWEVDPVPSVLLDRSVEITGPVDRKMMINALNSGAKMFM
ADFEDASSPTFANMIDGQVNMQDFARGKLAYTDAGSGKSYALNDKVAVMIVRPRGWHMEE
AHIFVDGRPISASLFDFGLHFYHNGKMLFEAGIGPFYYLPKMESHLEARLWDEVFEYAQG
EIGIPTGSIKATVLIETLPAAFEMDEILYELRRHIAGLNCGRWDYIFSYIKTLRNHADFV
LPDRAQVGMDRAFLNAYSLLLIKTCHRRRAHAMGGMAAQIPVKNDEAANDAAFAKVRADK
LREVKNGHDGTWVAHPALVPVALEVFNEHMALGNQVLSQRCFPPINQSALLKPHTGEITE
AGVRTNVSVGIEYTAAWLNGRGAVPIHNLMEDAATAEISRSQIWQWIHHGAQIIAADGAA
RTFTKAWFNDILADELGKVRAALGENGFKAGRYDVAAEIFTHTATSEELADFLTLPAYEA
LRTLA
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccacagccacacttgaacacccctccgccacccgcgcgaagatcgaagtgaag
ggcaaggccgccggtgtcgagcgcgtgctgacgccccaggcgctggcgttcattgaggcg
ctggagcgccgcttcggcgcccgccgccgcgaattgctcagcctgcggaaagagcgccag
gcgcggttcgatgccggtgaactgcccgattttctccccgagacgaaatccattcggaac
ggccattgggaagttgatcctgtgccgtccgtccttctggaccgctcggtcgagatcacc
ggcccggtggaccgcaagatgatgatcaacgcgctgaactccggcgccaagatgttcatg
gcagactttgaagacgcctcctcgccgacctttgccaacatgatcgacggccaggtcaac
atgcaggactttgcccgcggcaagctcgcctacaccgacgcgggctcgggcaaatcctac
gcgctgaatgacaaggttgcggtcatgatcgtgcgcccgcgcggctggcatatggaagaa
gcccacatcttcgtcgatggccggcccatctccgccagcctcttcgatttcggcctgcac
ttctatcacaatggaaagatgctgttcgaggccggtatcggcccgttttattacctcccc
aagatggagagccatctggaagcccgcctttgggacgaggtgtttgaatacgcacaaggc
gaaatcggcatcccgacgggctccatcaaggcaaccgtccttatcgagacattgccagcc
gccttcgagatggacgagatcctctatgaactgcgccgtcacatcgccggtctcaattgc
ggccgctgggattacatcttctcctatatcaagacgctgcggaatcatgcggacttcgtc
ctgccggaccgcgcgcaggtcggcatggaccgcgccttcctcaacgcctattcgctgctc
ctcatcaagacctgccaccgccgccgcgcccacgccatgggcggcatggccgcgcagatc
ccggtgaagaatgacgaggccgccaatgacgccgccttcgccaaggtgcgcgccgacaag
ctccgtgaagtgaagaatggccatgacggcacatgggttgcccaccccgcgctcgtgccc
gtcgcgctggaagttttcaacgagcatatggcgctcggcaatcaggtcctcagccagcgt
tgcttcccgcctatcaatcagtctgccctgctgaagccccacaccggtgagatcacagaa
gccggtgtgcgcacgaacgtgtccgtcggcatcgaatacaccgccgcctggctcaatggc
cgcggcgccgtgccgatccacaatctgatggaagacgccgccaccgccgaaatctcccgc
agccagatctggcagtggatacatcacggcgcgcaaatcatcgccgcagacggcgccgcc
cgcaccttcaccaaagcctggttcaacgacattctggccgatgaactcggcaaggtgcgc
gctgccctcggcgagaatggtttcaaggccggccgctatgatgtggccgccgaaatcttc
acccacaccgcgacctcagaagagctcgccgacttcctgacgctgcccgcctatgaagcg
ctgcgcacccttgcatga

DBGET integrated database retrieval system