KEGG   Hyphomonas neptunium: HNE_1239Help
Entry
HNE_1239          CDS       T00397                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
hne  Hyphomonas neptunium
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:hne01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:hne00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1260109..1261731
Genome map
AA seq 540 aa AA seqDB search
MSKRPTYAELRAQVQKRYPTGQAPGGVTVDDIVQLKMQNTYNTHLDIAREMAVVMRADMA
AYDQDHSKFTQSLGCWSGFHAQQMIKAVKRMKGTAKGTYVYLSGWMVAGLRNRFGHLPDQ
SMHEKTSVADLIEEIYVSLRQADEVALNDLFRELKAAREKGAPADVIETIIQRIDTFESH
VVPIIADIDAGFGNEHATYLLAKELIKAGACCIQIENQVSDAKQCGHQDGKVTVPREDFI
EKLRACRLAFEELGVDDGVIVARTDSLGAGLTQKVPVSQHAGDLASEYTKWLEVEEITPA
NPLKEGDLALQQNGRLVKPVRLANGLFKFQENTGADRVVEDCIANLTLGGADLLWIETDT
PDVDIIAGLVNRVKEAVPDAKLTYNNSPSFNWTLNLRKQVRKAWAAEGKIAEGEYPEAEL
MSAKFDDTPLGQEADARLKRFQYDISDRAGVFHNLITLPTFHMTAFATDQLSRGYFGEDK
MAAYVKTIQRQEIRNNVSAVKHQHEVGSDLGDTFKEMVAGERALKASGEHNTMNQFENVV
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacgccctacctatgccgagctgcgcgcccaggtccagaaacgttaccccacc
ggccaggcgcctggcggcgtgacagtggacgacatcgtccagctgaagatgcagaacacc
tacaacacccatctcgacatcgcccgcgagatggccgtcgtgatgcgcgccgatatggcc
gcttatgaccaggatcactcgaagttcacccagtcgcttggctgctggtcgggcttccat
gcgcagcagatgataaaggctgtcaagcgcatgaagggcaccgccaagggcacctatgtg
tacctttccggctggatggtcgctggcctgcgtaaccgtttcggccacctgccggaccag
tcgatgcatgagaaaacttcggtcgcagacctgatcgaggaaatctacgtctccctgcgc
caggctgatgaggtcgccctcaacgatctcttccgtgagctgaaagctgcccgtgaaaaa
ggcgcgccggccgatgtgatcgaaaccatcatccagcgtatcgacacgttcgaatcgcat
gtcgtgccgatcatcgccgacatcgatgccggcttcggcaacgagcacgccacctatctg
ctcgccaaggagctgatcaaggcgggcgcctgctgcatccagatcgaaaatcaggtgtcg
gacgcaaaacagtgcggccaccaggatggcaaggtcaccgtgccgcgcgaagacttcatc
gagaagctgcgcgcctgccgtctggcctttgaagaactcggcgtggatgacggcgtcatc
gtcgcccgcacagacagccttggcgctggcctgacgcagaaagtcccggtctcccagcat
gcgggcgatctcgcctcggaatacactaaatggctggaagtcgaagaaatcacgcccgcc
aatccgctgaaagagggcgatctcgcgcttcagcagaacggccgcctcgtgaaacccgtt
cgcctcgccaacggcctcttcaagttccaggaaaacaccggcgctgaccgcgtcgtggaa
gactgtatcgccaacctgacgctcggcggcgcagacctcctctggatcgaaaccgacacg
ccagacgtggacatcatcgcgggcctggtaaaccgcgtgaaggaagcagttccagatgcg
aagctcacctacaacaactcaccgtcgttcaactggacgctcaacctgcgcaaacaggtc
cgcaaggcctgggccgcagaaggcaagattgccgagggcgagtatccggaagcagagctg
atgtcggccaagtttgacgacaccccactcggccaggaagccgatgcgcgcctcaagcgc
ttccagtatgacatctccgaccgcgccggcgtgttccataacctgatcacgctgccgacc
ttccacatgacggccttcgccaccgaccagctctctcgcggctatttcggggaagacaag
atggccgcctatgtcaaaaccattcagcgccaggaaatccgcaacaacgtttcggctgtc
aaacaccagcacgaagtcggctcggaccttggcgacacgttcaaggaaatggttgccggt
gagcgcgccctgaaagccagcggcgagcacaacacgatgaaccagttcgagaacgtcgtc
tga

DBGET integrated database retrieval system