KEGG   Hyphomonas neptunium: HNE_1271Help
Entry
HNE_1271          CDS       T00397                                 

Definition
putative lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
hne  Hyphomonas neptunium
Brite
Enzymes [BR:hne01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     HNE_1271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1300272..1301537
Genome map
AA seq 421 aa AA seqDB search
MGGPLRTSAKGLELIKGFEGFRPRASRLPDGRWIVGYGHTRTARPGLQVTPQDAELVLAH
SDLPLIEQLIQDEVLAPLTQNEFDALVSFAWNIGPGAFQSSSVLANLNEGDRLSAASDMW
LWRKGRVSGEVKIIDALVRRRAAEISLFLTHPSGPAAVPGALIRPIPEDGGQPFPPASER
TVIIEARGEGEPLLPRGRTADTTPKAAARAVSERIARILGESPPPPPSTPGRTLAPGEEG
PSVEEITRAIADLAGPADDAPLPPATGGVRGAPDGIERRRPARTQPPSATVAPPPVEPAA
AAIIAAPPVPEALLPPAEAVIVDDLAPVEIDENGVQRALEENGHVTRPPGAETLGRWVPY
ALLSGLGLVSLVLGIGELIDMAAEPALHEGEAWLGPLLALGGGFLFVVATYYLYRAMTQD
E
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
ttgggtggtccgcttcgcacatctgcaaagggactcgagctgatcaaaggcttcgagggc
ttccggccgcgcgcaagccggctgccggatgggcgatggattgtgggctatggccacacg
cgcacggcgcggcctggcttgcaggtgacccctcaggacgctgaactggtgctggcgcat
tccgatctgccgctgatcgagcagctgatccaggatgaagtgctcgccccgctgacccag
aacgaatttgatgcgctggtgtcctttgcctggaatatcgggccgggcgcgttccagtct
tccagcgtgctggcaaacctcaatgagggcgacaggctctcggccgcatccgacatgtgg
ctgtggcgcaaggggcgtgtgagcggcgaggtgaagatcatcgacgcgctggtgcgccgg
cgggctgcggagatttcgctgttcctgacgcacccttcgggcccggcggcggtgcctggc
gcgctgatccggccgatccccgaagatggcgggcagcctttcccgccggcctctgaacgc
actgtcatcatcgaagcgcgtggcgagggcgagccgctgctgccgcgcggacgcacggcg
gacacgacgcccaaggctgcggcccgcgccgtgagcgagcggattgcgcgcattctgggc
gagagcccgccgccaccaccctcaacgccgggcaggacgctggcaccgggcgaggaaggc
ccgagtgttgaagagatcacccgcgcaattgccgatctggccggcccggcggatgacgcg
ccgctgccaccggcaaccggcggagtgcggggggcgcccgatgggattgaacgccgccgg
cccgcgcggactcagccgccgtctgccacggttgcgccgccgccggtagaacctgctgca
gccgcgatcattgcggcgccaccggtgcccgaagccctgctgcccccggcagaggcggtg
attgtggacgatctggcgcctgtggaaatcgatgaaaatggtgttcagcgcgcgctggag
gagaacgggcatgtgacccgtcctccgggcgctgaaacgctggggcgctgggtgccgtat
gcgctgctttccgggttggggctggtgagccttgttctgggcattggcgagttgatcgac
atggccgctgaaccggcgctgcatgaaggcgaagcgtggctggggccgctgctggcgctg
ggcggcgggttcctgtttgtggtggccacgtattacctttaccgggcgatgacgcaggac
gagtga

DBGET integrated database retrieval system