KEGG   Hyphomonas neptunium: HNE_1335Help
Entry
HNE_1335          CDS       T00397                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hne  Hyphomonas neptunium
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    HNE_1335 (glpK)
Enzymes [BR:hne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     HNE_1335 (glpK)
Exosome [BR:hne04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HNE_1335 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1367752..1369233
Genome map
AA seq 493 aa AA seqDB search
MSDFILVIDEGTTSTRAIVYDRDFREVALAQEEVALAYPRDGWVEQDGEEIWTRTLSVCR
AVIAKAGGAARIAAIGITNQRETTLVWDRKTGKPLAPAIIWQDRRTAAFCESLKAKGYES
DVQAETGLLLDPYFSGTKINWVLNNVPGAQARAEAGELAFGTVDSFLLWRLTGGTVHATD
VTNASRTLLYRLGIGGEGGWSAAMGEMLGVPAAMLPEVKPSAADFGTAGAALFGAAIPVA
SILGDQQSALVGQGCLAPGQAKITFGTGAFLVANTGAARPFSENRLLGTMGYALPGADAM
ALEGSIFNAGTVIKWLRDDLGLIQRADESAAAAASLKDNGGVYMVPALTGLGAPHWDAEA
RGLIAGLTRAATGAHLVRAGLESVAYQTHDLLAAFAGDGAPIGELRVDGGMVGNDWLMQF
LANVCALPVLRPDYREMTALGAAAAAAMQIGWLSAADWAAREVPGKRFEPDMSADARAAL
LKGWQTALGRALT
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgagcgactttattctcgtgatcgacgaaggcacgacctcgacgcgggcgatcgtctat
gaccgcgactttcgcgaggtggccctcgcgcaggaagaggtggcgctggcctatccccgc
gatggctgggtggagcaggatggcgaggagatctggacgcggacgctgtcggtctgccgg
gcggtgatcgccaaggcgggcggggcggcgcggattgcggcgatcggcatcaccaaccag
cgcgagacgacgctcgtctgggaccgcaagaccggcaagccgctggcgccggccatcatc
tggcaggaccggcgcacggcggcgttctgtgaaagcctcaaggcgaagggctatgagagc
gatgtgcaggccgagaccggcctgctgctggacccgtatttctccggcacgaaaataaac
tgggtactgaataatgttcccggcgcgcaggcgcgcgcagaggccggggaactggccttc
gggacggtggacagttttctgctgtggcggctgacgggcgggacggtgcatgccaccgat
gtgacgaatgcgtcgcgcacgctgctctaccggctgggtatcggcggcgaggggggctgg
agcgcggcgatgggcgagatgcttggcgtgcccgcggccatgttgcccgaggtgaagccg
agcgcggcggattttggcacggcaggggcggcgctgttcggcgcggcgatcccggtggcg
tcgatcctgggggatcagcaatcggcgctggtggggcaggggtgtctcgcgccggggcag
gcgaagatcacgtttggcacgggcgcgttcctggtggcgaatacgggcgcggcccggccg
ttttcggagaacagattgctgggcacgatgggctacgcgctgcccggcgccgacgcgatg
gcgctggaaggctcgatcttcaatgcgggcacggtgatcaaatggctgcgcgatgatctg
ggacttattcagagggcggatgaaagcgcagccgccgcggcgagcctgaaggataatggc
ggcgtctatatggtgcccgccctcaccgggcttggcgcgccgcattgggacgccgaagca
agggggctgatcgccgggctgacgcgggcggcgacgggggcgcatctggtgcgcgcgggg
ctggaatcggtggcctatcagacgcatgacctgctcgccgcgtttgcgggcgacggcgcg
ccgattggcgagctgcgcgtggatggcggcatggtggggaatgactggctgatgcagttt
ctggcgaatgtgtgcgcgctgccggtgctgcggccggactatcgcgagatgacggcgctg
ggcgcagcggcggctgcggcgatgcagatcggctggctgagcgccgccgactgggcggcc
cgcgaagtgccgggcaaacgcttcgagccagatatgagcgctgacgcccgcgccgcgctt
ctgaagggctggcaaaccgcgctcggccgcgcgctgacctga

  All links  
No link information was found.   
DBGET integrated database retrieval system