KEGG   Hyphomonas neptunium: HNE_1554Help
Entry
HNE_1554          CDS       T00397                                 

Definition
limonene-1,2-epoxide hydrolase (EC:3.3.2.8)
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
hne  Hyphomonas neptunium
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HNE_1554
Enzymes [BR:hne01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     HNE_1554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1578652..1579029
Genome map
AA seq 125 aa AA seqDB search
MTENEKIIREFIAAWSRLGVDEIVSYFADDGVYHNMPFRPVTGHGALKAFVGNFLKDWTE
TNWEILTLVSSGDIVVAERLDRTRLGTQAVDLPCCGVFVMEGGKIKVWRDYFDMATYTRG
ISGEA
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaacgaaaaaatcatccgggaattcatagccgcctggtcgcgtctgggcgtc
gatgaaattgtaagctatttcgccgacgacggcgtttaccacaacatgcccttcaggccg
gtgacaggccatggtgccctgaaagcatttgtcggcaatttcctgaaggactggacagag
acgaactgggagatcctgactctggtcagctcgggcgatattgttgtagccgagcgcctc
gatcgcacgagactgggaacgcaggctgtcgatcttccctgttgcggcgtgtttgttatg
gaaggcgggaagatcaaagtctggcgggactatttcgatatggcgacttacacgcgcggt
atatccggcgaggcatga

DBGET integrated database retrieval system