KEGG   Hyphomonas neptunium: HNE_1560Help
Entry
HNE_1560          CDS       T00397                                 

Gene name
narG
Definition
nitrate reductase subunit alpha (EC:1.7.99.4)
Orthology
K00370  
nitrate reductase alpha subunit [EC:1.7.99.4]
Organism
hne  Hyphomonas neptunium
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Two-component system
Module
Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    HNE_1560 (narG)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HNE_1560 (narG)
Enzymes [BR:hne01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.99  With other, unkown, acceptors
    1.7.99.4  nitrate reductase
     HNE_1560 (narG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1587604..1591338
Genome map
AA seq 1244 aa AA seqDB search
MSHTLDRLTFFRRQTETFSGGHGVLNDEDRTWEEAYRNRWRHDKIVRSTHGVNCTGSCSW
KIYVKGGIVTWETQQTDYPRTRDDLPNHEPRGCSRGASYSWYLYSANRVKYPLIRARLLK
AWRQARKTMQPVAAWKSIQDDPAKRADYVTRRGMGGFVRARWDEVNEIIAAANAHTVKQW
GPDRVFGFSPIPAMSMVSYAAGARYLQLIGGVTGSFYDWYCDLPPASPQTWGEQTDVAES
ADWYNSNFLILWGSNVPQTRTPDAHFYTEARYKGVKSVVICPDYSEASKFSDLWLAAKQG
TDAALGMAFGHVILTEYHRDREVPYFRDYVRQYTDLPLLVRLVPQEDGYVPERLLRASDF
DKSLGEDANPDWKTVAIDETTGKVVVPNGSIGFRWGDKGKWNLEERESGGADTKLRLGLK
GAEDEVAKVRFPYFANTASNGFASTDHPSVLTRNVPVRRMKLADGTETLVACVYDLLMAN
YGVDQGYGGEHLASSYDDMEPYTPAWAEAITTVPRANIIATARGFATNAEKTRGKSMIII
GAGMNHWYHMDMNYRAVMNMLILCGCIGQSGGGWSHYVGQEKLRPQTGWAPLAFATDWVR
PPRQQNSTSFFYAHTDQWRYETVPVDEILSPTAEAGDWAGSFIDYNAKAERMGWLPSAPA
LKTNPLEVAAKAKAAGQEPKDYVAAALKSGELEMSCMDPDDPHNWPRNMFVWRSNLLGSS
GKGHEYFLKHLLGTDHGIQGKDLGEMGHDKPRDVAWHDQAPRGKLDLLVCIDFRMSTTAV
YSDIVLPTATWYEKNDLNTSDMHPFIHPLGAAVDPAWESRTDWEIFKGLAKTFSEVAPEV
LGVETDVVLFPIQHDSPGEMAQTHGVKDWYKRECEPIPGKTMPTVVAVERDYSQIYAKFT
SLGPLMDKLGNGGKGMAWNTQHEVEKLASLNGTVLDETVAKGRPKIVTDIDACETILMLA
PETNGEVAVKAWEALEVQTGREHTHLARPKEDEKIRFRDIVAQPRKIITSPIWSGIESEH
VSYNAGYTNVHELIPWRTLTGRQQLYQDHDWMRAFGETLVVYKPPVDLKTLHVKGDKPNG
NPEITLNFITPHQKWGIHSTYTDNLLMLTLNRGGPVVWVSETDAKRAGIIDNDWVEVFNA
NGALTARAVVSQRIREGTMFMYHAQEKIVNTPGSEITGKRGGIHNSVTRAILKPTHMIGG
YAQLAYGFNYYGTVGSNRDEFIILRKMNKVDWLDTPAAQKEGVQ
NT seq 3735 nt NT seq  +upstreamnt  +downstreamnt
atgagccatacactcgacagactgactttcttccggcggcagactgagaccttttccggc
ggacacggcgttctcaatgatgaggaccgtacttgggaagaggcgtaccggaaccgctgg
cgccacgacaagatcgtgcgctcaacgcacggcgtgaactgcaccggctcgtgctcctgg
aagatttatgtcaaaggcggcatcgttacctgggagacccagcagactgattatccccgg
acgcgagacgatctgccaaaccatgaaccgcggggatgctcgaggggcgcaagctacagc
tggtatctctattcagctaaccgggttaaatatccgctgatccgggcccggcttctgaaa
gcctggcggcaagcccgcaagactatgcagcccgtggcggcctggaaatccattcaggat
gatccggccaagcgcgcagactatgtgacgcgccgcggcatgggcgggttcgtccgggcc
cgctgggatgaggtgaatgaaatcattgccgcagccaacgcgcacacggtcaagcaatgg
ggcccggaccgcgtgttcggcttctcgcccattccggcgatgtcgatggtttcgtacgca
gccggtgcgcgctatctccagctcatcggcggggtgactggctccttctatgactggtat
tgcgacctgccccctgcgagcccgcagacctggggcgagcagaccgacgttgccgaaagc
gctgactggtacaattccaatttcctgatcctttggggctcgaatgtgccccagacgcgc
acgccggatgcgcacttttacaccgaagcccgctataagggcgtcaaatcagtcgtgatc
tgcccggattattcggaagcttctaaattctccgacctctggctcgcggccaagcagggc
accgatgcagcgctcgggatggctttcggtcacgtcattctgacggaatatcaccgtgac
cgagaagtcccgtatttccgtgactatgtgcgccagtacaccgacctgccgctgctcgtt
cgcctcgtgccgcaggaagacggctatgtgcccgagcgccttttgcgcgcctccgatttc
gacaagtcccttggcgaggacgccaatccagactggaagaccgttgcgatcgacgagaca
accggcaaggtcgtggtgccgaacggctctatcgggttccgttggggcgacaagggcaaa
tggaacctcgaggagagggaaagcggcggagctgacacgaagctccggctcggcctgaag
ggggccgaggacgaggtggccaaggtccgcttcccgtatttcgccaataccgcctcgaac
ggctttgcctccacagatcatccgagtgtcctgacgcgcaatgtccccgtcagaaggatg
aaactcgcagacggcacagagacactggtcgcctgtgtctatgacctcctgatggctaat
tatggcgtcgatcagggctatggcggcgagcatctcgccagttcctatgatgacatggag
ccctacacgccggcctgggctgaggccatcaccactgtgccacgcgcgaacatcattgcc
acggcccgtggttttgccaccaacgcagagaagaccaggggtaagtcgatgatcatcatc
ggcgcagggatgaaccactggtaccatatggacatgaactaccgcgcggtgatgaacatg
ctcatcctgtgcgggtgcatcggacagtccggcggcggctggtcccattatgtggggcaa
gagaagctccgtccccagacggggtgggcgccgcttgcctttgcgaccgactgggtacgt
ccgccgcgccagcagaattcgacttcctttttctatgcgcatacagatcagtggcgttat
gaaacggttccggtcgatgagatcctgtctccaaccgccgaagcgggtgactgggcgggt
agcttcatcgactataatgccaaggccgagcgtatgggctggttgccatcggccccggcg
ctgaagaccaaccctctggaagtggccgcgaaggccaaggccgccgggcaggagccgaag
gactatgtcgccgcggcgctcaaatccggtgagttggaaatgtcctgcatggacccggac
gatccgcataactggccgcgcaacatgtttgtctggcgctccaacctgcttggctcttcc
ggcaaggggcacgaatatttcctcaagcacctgctcggcaccgatcatggcatccagggc
aaggatcttggcgaaatgggccatgacaagccgcgcgatgtggcctggcatgaccaggcg
ccgcgcggaaagctcgacctgctcgtttgcatcgatttccgcatgtccaccacagcggtc
tattccgacatcgttctgccgacggccacatggtatgaaaagaatgatctcaatacctcc
gacatgcaccccttcatccacccgctgggagctgcggtggacccggcatgggaaagccgc
actgattgggaaatcttcaaagggctcgccaaaaccttctccgaggtggcccctgaagtg
cttggcgtcgagaccgatgtcgtcctcttcccgatccagcatgacagccctggcgaaatg
gcgcagacccatggcgtcaaggactggtacaagagggaatgcgaaccaatcccgggcaag
accatgcctacggttgtcgctgttgagcgcgactatagccagatctatgcgaagtttacg
tcgctcggcccgctcatggacaagctcggcaatggcggcaaggggatggcctggaatact
cagcatgaggtcgagaagcttgcctcgctgaacggcacggtgcttgacgaaaccgtcgct
aagggccgtccaaagatcgtgacggacatcgacgcctgcgagaccatcctgatgctcgcg
ccggagacgaatggagaagtggcggtcaaagcgtgggaagcactggaagtgcagaccggg
cgcgagcacacacacctcgcaaggccgaaggaggacgagaagatccgcttccgcgacatc
gtcgcccagccgcgcaagatcatcacctcgccaatctggtcagggatcgaaagcgagcat
gtgagctacaatgccggttacacaaacgtccacgaactgattccatggcgcacgctgacc
ggacgtcagcagctctaccaggatcatgactggatgcgggcgtttggtgagacgctggtg
gtctacaagccgccggtcgacctgaagacgctgcacgtgaagggcgacaagccaaacggc
aatcccgagatcacgctcaacttcatcacgccccaccagaaatggggcatccactcgacc
tatactgacaacctcctgatgctgacgctgaaccgcggcgggccggtcgtctgggtgtcc
gagaccgacgcgaagcgtgccgggatcatcgacaatgactgggtcgaggtcttcaacgca
aacggcgctctgacagcccgggcggttgtctcccagcggatccgtgaaggaacgatgttc
atgtatcatgcgcaggagaaaatcgtgaacacgccgggttcggagataactggcaagcgg
ggcggtatccacaattccgtcacccgcgcaattctcaaacccacacacatgattggcggc
tacgcacagcttgcctatggcttcaactattacggcacggtcggatcgaaccgggacgag
ttcatcattctgaggaagatgaacaaggtcgactggctcgatacccccgccgctcaaaag
gagggcgtacaatga

DBGET integrated database retrieval system