KEGG   Hyphomonas neptunium: HNE_1643Help
Entry
HNE_1643          CDS       T00397                                 

Definition
aspartate kinase (EC:2.7.2.4)
Orthology
K00928  
aspartate kinase [EC:2.7.2.4]
Organism
hne  Hyphomonas neptunium
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Ectoine biosynthesis, aspartate => ectoine
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:hne01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hne01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:hne00260]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:hne00270]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:hne00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1679469..1680917
Genome map
AA seq 482 aa AA seqDB search
MKRTVEKIGGTSISNTQVVLENVLIGGRKGADLYNRIFVVSAYSGMTNRLLEHKKSGEPG
VFSLFAGAGNKWAWTEALASVAEAMEAKNAEMFSGEPEQAVADNFVRERIEDVRNCLIDL
HRLCSYGQFRLDENLTTVKEVLSSLGEAHSAFNTALLLQKHGVNARAVDLTAWRDERDLT
MEERMEDALGGIDLSSELPIVTGYASSRDGLVRQFGRGYTEVTFSRLAAFVQADEAIIHK
EFHLSSADPNLVGQDRVRKIGLTNFDVADQLSNMGMEAVHPKAAKILRQAGIPLRVKNTF
DPKDGGTVISADYAPENPRAEIVTGLKGVFALEVFDQDMVGEKGYDSTILDALTRHSIRI
VSKCSNANTITHYIEGSRKALKRATADIETKLPGAEVSTSRVAIVSVIGADINVPGITAK
ALTALHEAEVPIIGLHQVSRKTDIQAVIQEDDFDKAICALHEALVEQVSVATPRAEALRP
AA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcacagtcgaaaagatcgggggcacctcgatctccaacacgcaggtcgtgttg
gaaaacgtgctgatcggaggccgcaagggcgccgatctctataaccgcatcttcgttgtg
tcggcctattctggcatgacgaaccgcctgctggaacacaagaaatccggcgagccgggc
gtgttcagcctgtttgccggtgcaggcaacaaatgggcctggaccgaggcgctcgcctct
gtcgccgaagccatggaagccaagaacgctgaaatgttctctggtgagcccgaacaggcc
gtcgcggacaattttgtgcgggaacggatcgaagacgttcgcaactgcctgatcgatctc
caccgcctctgttcctacggccaattccgtctggacgaaaacctcaccaccgtgaaggaa
gtcctctcttccctcggcgaggcgcactccgccttcaacacggcgcttctcctgcagaaa
cacggcgtgaacgctcgcgctgtcgatctgacggcatggcgcgacgagcgggacctgacc
atggaagagcgtatggaagatgccctcggcggcattgacctgtccagcgaacttcccatc
gtcaccggctatgccagcagccgcgacggcctcgtccgtcagttcggccgggggtacaca
gaggttacattctcgcgtttggccgccttcgtccaagccgatgaagcgatcattcacaag
gagttccacctctccagcgccgaccccaatctcgtgggtcaggaccgggtccgcaagatc
ggcctgaccaactttgatgtggccgaccagctctccaatatgggcatggaagcggtccac
cccaaagccgccaagatcctgcgccaggcgggcatccccctgcgcgtcaagaacaccttc
gaccctaaggatggcggcaccgtcatctcggcagactacgccccggaaaacccccgcgcc
gaaatcgtcacgggcctaaagggtgtcttcgcgctagaagtcttcgatcaggacatggtc
ggtgagaagggctacgattccaccatcctcgatgccctcacgcgccattccatccgtatc
gtgtcgaaatgctcgaatgccaacacgattacccactatatcgagggcagccgcaaagca
ctcaagcgtgccaccgcggacatcgagacaaagctccccggcgcggaagtctccaccagc
cgcgttgccatcgtctcggtcatcggcgcagacatcaacgtgcccggcatcacggccaaa
gcgctcacagccctgcatgaagctgaagtgccgatcatcggtctgcatcaggtttcacgg
aaaaccgacattcaggccgtcatccaggaagatgatttcgacaaggccatctgcgccctg
cacgaagcgctggtcgaacaggtaagcgttgccacgccgcgcgctgaggccttgcgcccg
gcggcatga

DBGET integrated database retrieval system