KEGG   Hyphomonas neptunium: HNE_1741Help
Entry
HNE_1741          CDS       T00397                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hne  Hyphomonas neptunium
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HNE_1741 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HNE_1741 (glk)
   00052 Galactose metabolism
    HNE_1741 (glk)
   00500 Starch and sucrose metabolism
    HNE_1741 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HNE_1741 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HNE_1741 (glk)
   00524 Butirosin and neomycin biosynthesis
    HNE_1741 (glk)
Enzymes [BR:hne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HNE_1741 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1784312..1785280
Genome map
AA seq 322 aa AA seqDB search
MEGSVLVGDVGGTNVRFALAARRNGALSIEHFQKFQGDDFESFEDALKQYLDKTGVRATV
ACFAMAGPVRDQKVTLTNRAKWQVSSTGLEARFGFEAVRLINDFQAMARSVPEFSVSSFE
EILPGTSQTGAPMLVAGPGTGFGVATLLAGANGQWSVVSGEGGHMAYAPRTDIEHDLARL
LARDHGYVSNELVASGSGLEEVHRAFCEIFDRDCLNLSPETMRQRADDGDEMFQTLIEVR
ALAVMGAAGDLVLANGALGGVVLAGGVSERISEFLKTPLARQRFTSRGPMSDYLETCPVW
LMRDASAPLIGAAAYFEQPSRI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggaaggttccgtcctggtcggagatgtcggcggcacaaatgtgcgctttgccctcgcg
gcgcgccggaacggcgctctgagtatcgagcattttcagaagtttcagggagatgatttc
gagtcgtttgaggatgctctgaagcagtatctggacaagacaggcgtgagggcaactgta
gcctgctttgcgatggctggccctgtaagggatcagaaagtcacgctgacaaaccgggca
aaatggcaagtttcatcgacgggattggaggcgcgattcggctttgaggccgtgcgcctc
atcaatgatttccaggcaatggcccgctcggtgccagaattctccgtctcgtcatttgag
gaaatccttccgggaacgtcccagacaggcgcgccgatgctggtggcggggccgggcaca
ggattcggcgtggcaacgctgctggcaggcgcgaacggtcagtggagcgtcgtatcgggc
gaaggtggccatatggcctacgcgccgcgcacagacatcgagcatgatctggcgcggctg
ttggcgcgcgatcatggctatgtgtcgaatgagttggtcgcctccggcagcggtcttgaa
gaggttcatcgggcattttgtgagatatttgatcgcgattgtctcaatttgtctccggaa
acgatgcgtcaacgggcggatgacggcgatgagatgttccaaacgctcattgaagtgcgg
gcactcgctgtcatgggcgcggcaggtgatctcgtgctggcaaatggcgccctgggcggg
gtcgtgctggcgggcggggtcagtgagcgtatttctgagttcctgaaaacgcccctcgcg
cggcaacgcttcacctctcgtggccccatgagtgactaccttgagacttgcccggtgtgg
ctgatgcgcgatgcatccgcgcccctgattggcgccgcagcctactttgaacagccttcc
cgaatctag

DBGET integrated database retrieval system