KEGG   Hyphomonas neptunium: HNE_1792Help
Entry
HNE_1792          CDS       T00397                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hne  Hyphomonas neptunium
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HNE_1792 (tpiA)
   01230 Biosynthesis of amino acids
    HNE_1792 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HNE_1792 (tpiA)
   00051 Fructose and mannose metabolism
    HNE_1792 (tpiA)
   00562 Inositol phosphate metabolism
    HNE_1792 (tpiA)
Enzymes [BR:hne01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HNE_1792 (tpiA)
Exosome [BR:hne04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HNE_1792 (tpiA)
  Exosomal proteins of bladder cancer cells
   HNE_1792 (tpiA)
  Exosomal proteins of melanoma cells
   HNE_1792 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1837029..1837778
Genome map
AA seq 249 aa AA seqDB search
MPRTLIAGNWKMNGLMANLAEVERVAAEVPASSEGAETLLCLPATLIHAGSAKSEGSGLK
IGGETCHANEKGAHTGDLAAEMLKDAGASYVIVGHSERRADHGETDAVVAAQASAALRAG
ITPIICVGETLDQRDAGEVLTVITTQMAESIPEGAEAAAIVIAYEPVWAIGTGRVATSEQ
IAEVHTSIRNLLVRRFGDAGRTTRILYGGSMNPGNAAEILAVAEVNGGLIGGASLKAADF
LAIYRLAAQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgccacgcacgctgatcgccggaaactggaaaatgaacggtctgatggcgaatctcgcc
gaggtcgaacgggtcgccgcagaggttcccgcatcaagtgagggggctgaaacgctgtta
tgccttcctgcaacgttgattcacgcaggttcggcaaaatctgaaggatcgggcctgaaa
attggcggagaaacctgccacgccaacgaaaagggcgcccataccggcgatcttgcagca
gaaatgctcaaagatgccggcgccagctatgtcattgtggggcactcagagcgccgcgcg
gaccatggcgagacagatgccgtagtggctgcgcaggcctcggctgcattgagagcaggg
atcaccccaatcatctgcgttggcgaaacccttgaccaacgtgatgctggggaagtgctc
actgtcatcacgacgcagatggcagaatcgattcccgagggtgctgaggcagccgcaatc
gtcattgcttatgagccggtttgggccattgggaccggccgtgtcgccacttccgagcaa
attgccgaagtgcacacgtcgatccggaaccttctggtgcgccgatttggcgacgcaggg
cgcacgacccgtatcctttatggcggtagcatgaaccccggaaatgctgccgaaatcctc
gctgtggccgaggtaaatggcggcctgattgggggggcaagcttgaaggcggcggacttc
ctcgccatttaccggttggcggcgcagtag

DBGET integrated database retrieval system