KEGG   Hyphomonas neptunium: HNE_1878Help
Entry
HNE_1878          CDS       T00397                                 

Gene name
sdaA
Definition
L-serine ammonia-lyase (EC:4.3.1.17)
Orthology
K01752  
L-serine dehydratase [EC:4.3.1.17]
Organism
hne  Hyphomonas neptunium
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HNE_1878 (sdaA)
   01230 Biosynthesis of amino acids
    HNE_1878 (sdaA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HNE_1878 (sdaA)
   00270 Cysteine and methionine metabolism
    HNE_1878 (sdaA)
Enzymes [BR:hne01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.17  L-serine ammonia-lyase
     HNE_1878 (sdaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1941686..1943062)
Genome map
AA seq 458 aa AA seqDB search
MLSVLDIFRVGIGPSSSHTVGPIRIANRFMAHLASSEKLSRTARIEAELQGSLALTGVGH
ATPKAVVLGLLGLDPETLDAEEADRLVAQAYEQKVLPLPDGRKMKFDPETDIRFAYDVMP
DLHPNGLRIKAYDEGGEVIADETWYSTGGGFIATRKQLEKPVEDDILPVGDPVPFGFTSA
AQLLELCQTNGLGIYEVILANEDAKRPREKTEAALDRIAAVMMACIDRGLMRKGELPGGL
KVRRRAPEIWQKLQEGPPSNEREQLFDWLNVYAMAVNEENAAGGQVVTAPTNGAAGIIPS
VIRHYCADTEDAPERMRKFLLTAGGIGLLYKQRASISGAEMGCQGEVGVACSMAAGGLAA
VWGGTPQQVANAAEIGMEHNLGLTCDPVGGLVQIPCIERNAIGAVKAANAARLALHSLEQ
TKVSLDQVIETMRQTGLDMSSKYKETSQGGLAVNVIEC
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcggtattggatatttttcgggttggcattgggccttcgagttcgcacacggtg
ggtccgatccgcattgcaaaccggttcatggcgcatctggccagttcggaaaagctatcg
cgaacggcacggattgaggcagagttgcaggggtcactcgcgctgacgggtgtggggcac
gcgacgcccaaagccgtggtgctgggtctgctggggctcgaccctgaaacgctggatgcg
gaggaagcagaccggctggtcgcgcaagcgtatgagcagaaggtgctgccattgcccgat
ggccggaagatgaaattcgatccggagacggatattcggtttgcctatgatgtcatgcca
gacctgcacccgaacgggcttcggatcaaggcatatgacgaaggcggcgaagtgattgcc
gacgagacgtggtattccacgggaggcggatttatcgcgacgcgcaaacagctggaaaag
cctgtcgaggatgacattctgccggtgggggaccctgtgccgtttggttttacctcggct
gctcaattgctggaactctgccagacaaatggcctcggcatttatgaggtcatcctggcg
aatgaagacgccaaacggccacgcgagaaaacagaagccgcgctggaccggattgcggcg
gtgatgatggcttgcattgatcgtggattgatgcggaagggggagctgccgggcggcttg
aaggttcgccgccgcgccccggagatctggcagaaattgcaggagggcccgccctccaat
gagcgcgagcagttgttcgattggctgaatgtttatgccatggctgtgaatgaagaaaac
gctgcgggcgggcaggtggtgacggcgccaacaaatggcgcggccggtatcataccgtcc
gtaatccggcattattgtgccgataccgaagacgcgccggagcgtatgcggaagtttctg
ctgaccgccggcgggattgggctgctttacaagcagcgggcgtcaatttcgggcgctgag
atgggatgccagggtgaggtgggggtcgcttgctcgatggcggcgggcggtcttgcggcg
gtttggggcggcacgccacaacaggtggctaatgcggcggagatcgggatggagcacaat
ctggggcttacctgcgatcctgtaggcggccttgtgcaaattccctgtattgagcggaac
gcgattggcgccgtgaaagcggccaatgctgcccgcctggcgctgcattccctcgaacag
acgaaagtctctctggatcaggttatcgagacgatgcggcagaccggattggacatgtca
tccaaatataaggagaccagccagggcggtctcgcggtcaatgtgatcgaatgctag

DBGET integrated database retrieval system