KEGG   Hyphomonas neptunium: HNE_1878Help
Entry
HNE_1878          CDS       T00397                                 

Gene name
sdaA
Definition
L-serine ammonia-lyase (EC:4.3.1.17)
Orthology
K01752  
L-serine dehydratase [EC:4.3.1.17]
Organism
hne  Hyphomonas neptunium
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:hne01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hne01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:hne00260]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:hne00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1941686..1943062)
Genome map
AA seq 458 aa AA seqDB search
MLSVLDIFRVGIGPSSSHTVGPIRIANRFMAHLASSEKLSRTARIEAELQGSLALTGVGH
ATPKAVVLGLLGLDPETLDAEEADRLVAQAYEQKVLPLPDGRKMKFDPETDIRFAYDVMP
DLHPNGLRIKAYDEGGEVIADETWYSTGGGFIATRKQLEKPVEDDILPVGDPVPFGFTSA
AQLLELCQTNGLGIYEVILANEDAKRPREKTEAALDRIAAVMMACIDRGLMRKGELPGGL
KVRRRAPEIWQKLQEGPPSNEREQLFDWLNVYAMAVNEENAAGGQVVTAPTNGAAGIIPS
VIRHYCADTEDAPERMRKFLLTAGGIGLLYKQRASISGAEMGCQGEVGVACSMAAGGLAA
VWGGTPQQVANAAEIGMEHNLGLTCDPVGGLVQIPCIERNAIGAVKAANAARLALHSLEQ
TKVSLDQVIETMRQTGLDMSSKYKETSQGGLAVNVIEC
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcggtattggatatttttcgggttggcattgggccttcgagttcgcacacggtg
ggtccgatccgcattgcaaaccggttcatggcgcatctggccagttcggaaaagctatcg
cgaacggcacggattgaggcagagttgcaggggtcactcgcgctgacgggtgtggggcac
gcgacgcccaaagccgtggtgctgggtctgctggggctcgaccctgaaacgctggatgcg
gaggaagcagaccggctggtcgcgcaagcgtatgagcagaaggtgctgccattgcccgat
ggccggaagatgaaattcgatccggagacggatattcggtttgcctatgatgtcatgcca
gacctgcacccgaacgggcttcggatcaaggcatatgacgaaggcggcgaagtgattgcc
gacgagacgtggtattccacgggaggcggatttatcgcgacgcgcaaacagctggaaaag
cctgtcgaggatgacattctgccggtgggggaccctgtgccgtttggttttacctcggct
gctcaattgctggaactctgccagacaaatggcctcggcatttatgaggtcatcctggcg
aatgaagacgccaaacggccacgcgagaaaacagaagccgcgctggaccggattgcggcg
gtgatgatggcttgcattgatcgtggattgatgcggaagggggagctgccgggcggcttg
aaggttcgccgccgcgccccggagatctggcagaaattgcaggagggcccgccctccaat
gagcgcgagcagttgttcgattggctgaatgtttatgccatggctgtgaatgaagaaaac
gctgcgggcgggcaggtggtgacggcgccaacaaatggcgcggccggtatcataccgtcc
gtaatccggcattattgtgccgataccgaagacgcgccggagcgtatgcggaagtttctg
ctgaccgccggcgggattgggctgctttacaagcagcgggcgtcaatttcgggcgctgag
atgggatgccagggtgaggtgggggtcgcttgctcgatggcggcgggcggtcttgcggcg
gtttggggcggcacgccacaacaggtggctaatgcggcggagatcgggatggagcacaat
ctggggcttacctgcgatcctgtaggcggccttgtgcaaattccctgtattgagcggaac
gcgattggcgccgtgaaagcggccaatgctgcccgcctggcgctgcattccctcgaacag
acgaaagtctctctggatcaggttatcgagacgatgcggcagaccggattggacatgtca
tccaaatataaggagaccagccagggcggtctcgcggtcaatgtgatcgaatgctag

DBGET integrated database retrieval system