KEGG   Hyphomonas neptunium: HNE_1975Help
Entry
HNE_1975          CDS       T00397                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase complex, E2 component, dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hne  Hyphomonas neptunium
Pathway
hne00010  Glycolysis / Gluconeogenesis
hne00020  Citrate cycle (TCA cycle)
hne00620  Pyruvate metabolism
hne01100  Metabolic pathways
hne01110  Biosynthesis of secondary metabolites
hne01120  Microbial metabolism in diverse environments
hne01130  Biosynthesis of antibiotics
hne01200  Carbon metabolism
Module
hne_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HNE_1975 (pdhC)
   00020 Citrate cycle (TCA cycle)
    HNE_1975 (pdhC)
   00620 Pyruvate metabolism
    HNE_1975 (pdhC)
Enzymes [BR:hne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HNE_1975 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N ATP-synt_ab_Xtn QRPTase_N Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: ABI76488
UniProt: Q0C0R8
Position
complement(2046976..2048307)
Genome map
AA seq 443 aa AA seqDB search
MAINITMPALSPTMEEGTLAKWLVKEGDTVKSGDIIAEIETDKATMEVEAVDEGTVAKIV
VAEGSEGVKVNAVIAVLAEDGEDASSVKTPSADAAPKKEEKKEDAPKAGEKKPDEKKPEP
KKEEAKPEPAKAAAPAKSDDGARLKASPLAKRIAANKGIDLKALKGSGPHGRIIKRDVES
AKPGAQAATAGAAAPASPDGLILPQILDDRVYAPDTYELKPLDGMRKTVARRLTQSFMQV
PHFPLNIDITLDNLLTSRASINNAAREGVKVSVNDLLIKAAALALMDEPDCNASFTDKGI
AYHKHANVSVAVAVEGGLITPVIFKAETKGLAEISEEMKDLAARARERKLKPQEYMGGTF
SISNLGMFGIKSFASIINPPEGMILSVGAGEKRAVVDEKGNVAVRTIMSVTLTCDHRVIG
GAEGAKWLTAFKRYVETPEAMLL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggccatcaacatcaccatgcccgctctcagccccacgatggaagagggcacgctcgcc
aaatggctcgtcaaggaaggcgacaccgtcaagtccggcgacatcatcgccgagatcgag
accgacaaggcgacgatggaagtcgaagccgtcgatgaaggcactgttgcaaaaatcgtc
gtggccgaaggctccgaaggggtaaaggtcaacgccgtcatcgccgtcctggccgaggac
ggcgaggatgcctcatccgtaaagacgccgtcggccgacgctgcgccgaagaaggaagag
aagaaggaagacgctccgaaggctggagaaaagaagcccgacgagaagaagcccgaaccg
aaaaaggaagaggccaaacccgagcccgctaaagcggccgctccggccaagtcggatgat
ggtgcgcgcctcaaagcctcccccctcgccaagcgcatcgcggcaaataaaggcatcgac
ctcaaagccctcaaaggctccggcccccatggccgcatcatcaaacgcgatgtggaaagc
gccaagcctggcgcgcaggcggctactgctggcgccgcagcgcctgcttcgcccgatggg
ctcatcctgccgcagatcctcgacgaccgggtctatgcgcccgatacctacgagctgaaa
ccgctcgatggcatgcgcaagaccgtcgccaggcgcctgacgcagagcttcatgcaggtg
ccgcatttcccgcttaacatcgacatcacgctcgacaatctgctgaccagccgagcctcg
atcaacaacgctgcccgcgaaggcgtgaaggtctcagtcaacgacctcctcatcaaggcc
gccgcgctcgcgctgatggatgagcccgactgcaatgcatcgttcacggacaaaggcatc
gcctatcacaagcatgccaacgtctccgtcgccgtcgcggtcgaaggcggcctgatcacc
ccggtgatcttcaaggccgaaaccaagggcctggctgaaatctccgaagagatgaaagac
ctcgccgcccgcgcgcgcgagcgcaagctgaagccccaggaatatatgggcggcaccttc
tccatctcgaacctcggcatgttcggcatcaaatccttcgcctcgattatcaacccgccc
gaaggcatgatcctttcggtcggcgccggcgaaaaacgtgccgtggtcgacgagaagggc
aatgtcgccgtacggacgatcatgagcgtcaccctcacctgcgaccaccgcgtcatcggc
ggcgcagagggcgccaaatggctgacggcgttcaagcgctatgtggaaacgcccgaagcg
atgctgctttag

DBGET integrated database retrieval system