KEGG   Hyphomonas neptunium: HNE_2272Help
Entry
HNE_2272          CDS       T00397                                 

Definition
putative DNA polymerase III chi subunit
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
hne  Hyphomonas neptunium
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HNE_2272
   00240 Pyrimidine metabolism
    HNE_2272
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    HNE_2272
   03430 Mismatch repair
    HNE_2272
   03440 Homologous recombination
    HNE_2272
Enzymes [BR:hne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     HNE_2272
DNA replication proteins [BR:hne03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     HNE_2272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2372760..2373230)
Genome map
AA seq 156 aa AA seqDB search
MQPAAPEWWFYHLSRSALEEAAAPLLQKCLEVGWRVLAVSPRAERLAKLDAVLWTFDDAS
FLPHGQADAPGLDVARQPVLLSAKLTNANSADALMLMDGVEAPVDVAFKRCMVMFEDADT
GTRNKARAQFKAAKDAGLTTRYFQQTERGGWKEAGV
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgcagccagcagcccccgaatggtggttctaccatctctcgcgcagcgcgctggaggag
gccgccgcgccgctcctgcagaaatgcctcgaagtcggctggcgcgtgctcgccgtgtct
ccgcgtgcggagcgtctggcaaagctcgacgccgtgctctggaccttcgacgacgcctcc
ttcctgccgcatggccaggccgatgcgccgggtctggatgtcgcccgccagccagtgctg
ctgtcggcaaagctcaccaacgccaacagcgccgatgccctgatgctgatggacggcgtg
gaggcgccggtggacgtggccttcaagcgctgcatggtgatgttcgaagacgccgacacc
ggcacccgcaacaaggcgcgcgcccagttcaaggccgcaaaagatgccggcctcaccacc
cgctattttcagcagacggaacgtggcggctggaaagaggcgggggtttaa

DBGET integrated database retrieval system