KEGG   Hyphomonas neptunium: HNE_2420Help
Entry
HNE_2420          CDS       T00397                                 

Definition
putative L-ribulose-5-phosphate 4-epimerase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hne  Hyphomonas neptunium
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HNE_2420
Enzymes [BR:hne01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HNE_2420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2527861..2528514
Genome map
AA seq 217 aa AA seqDB search
MSEQETKLREQVVEVMAAMDARGLNRGTSGNVSARLGEDMLVTPTGVPPSMLAPEHIVRM
APDGSFDPAGMKPSSEWQMHWKLLQLRQDVNAVVHCHSRFATTLACANKPIPALHYMVAV
SGGPSVPVAPYATFGSAELAEAVCETLSGQFGTLMANHGQIVVAPSLKQALLIAEEIEEQ
AAIYWGTLAIGGPTLLADDEMTRIADRFRSYGQKKKP
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacaggaaacaaagctgcgcgagcaggtggttgaggtgatggcggcgatggat
gcgcgcggcctgaaccggggcacttcgggcaatgtgtcggcgcggctgggcgaggatatg
ctggtgacgccgacgggggttccgccctcgatgctggcgccggaacatatcgtgcggatg
gcgccggatgggagctttgatccagcgggcatgaagccgtcgagcgaatggcagatgcac
tggaaactgttgcagctgcgccaggatgtgaacgccgtggtgcattgccattctcgcttt
gcaacgacgctggcctgcgcgaacaagcccatccctgccctgcattatatggtggctgtg
agcggggggccttctgtgccggtggcgccttatgcgacatttggatctgctgagttggcc
gaggccgtttgcgagacactttcgggacaattcgggacacttatggccaatcacggacaa
atcgtggtcgcgccgagcctcaaacaggcgcttctgatcgccgaggagattgaggaacag
gcggccatctattggggcacgttggccatcggcggaccgaccctactggccgatgatgag
atgacgcgcatcgctgaccggttccggtcctatgggcagaagaagaagccttga

DBGET integrated database retrieval system