KEGG   Hyphomonas neptunium: HNE_2455Help
Entry
HNE_2455          CDS       T00397                                 

Definition
alkaline phosphatase (EC:3.1.4.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
hne  Hyphomonas neptunium
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hne00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:hne00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:hne02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2574343..2575878)
Genome map
AA seq 511 aa AA seqDB search
MFSRRSFIVLAGAAAAASQQRSRAQTGARFFSLGIASGSPGPDSVILWTRLAPDPLNGGG
MTPGRADVRVRVARDPAMRNVIRDDMVATTGAKAHSVHYKVEGLEPGREYWYQFSYDGED
TVIGRTRTTNPKDAEARIALAYCQSYEGGFYAAYRDMAEWLPDLVIHTGDYIYEGGIGKL
GATMRDVGGGERRLFETVRLHNSSEIVSLFDYRNRYALYKSDPDLQAAHAAAPWIVAMDD
HEIDNNWAGDLPQDPDKQTALEFKVRKLAAFQAYYEHMPIEAPPVISGVQSGLQMYGLYR
LGPAQVHLLDTRQFRTNQPCGDGRKVSCEEALDPAQTMLGGDQEKWLFRELTRSNAPFNL
IATQVWFTPYRYNAPPEAPQMNFDSWDGYPLARQRLSDVLAQGVRNPVFLTGDWHTAMAS
TVYQTPLDTRSKRIGHELVGASISSGCPWARDMEIMRDANPHVAHLNGNKRGYLRVTVKK
DDCIGDFRVVEDVGRANSAVTSELEIHTKDI
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgttctctcgcagatcatttatcgtactcgccggcgccgctgccgcggcctcgcagcag
cgtagccgggcacaaaccggcgcacgctttttctctctcggcattgcttctggttcccct
ggtccagatagtgtcatcctctggacacgcctcgcgcctgatccgctgaacggcggcggc
atgacgcccggacgcgcagatgtgcgggtgcgcgtggcgcgcgatccggcgatgcggaat
gtcatccgtgacgatatggtcgcgacgaccggtgcgaaagcccattcggtgcattacaag
gttgagggcctcgagcctggccgcgagtactggtaccagttcagctatgacggtgaggat
accgttatagggcgcacacgaacgacaaatccgaaagatgccgaagcgaggatcgcgctg
gcctattgtcagagttatgagggcgggttctatgccgcctatcgcgatatggccgagtgg
ttgcccgatctcgtaattcatactggtgactacatttatgaaggcggcattggaaagctc
ggcgcgacgatgcgcgatgtgggcggaggtgagcgccggctgtttgagaccgtgcgcctt
cacaacagctctgagatcgtcagcctgttcgattaccgcaaccggtacgcgctctataaa
tccgatcccgatctgcaggcagcccatgcggcggcgccctggatcgtcgcaatggacgat
catgagatcgataataactgggccggagacctgcctcaggaccccgacaagcagacggca
ctcgaattcaaggtccgcaagcttgccgcttttcaggcatattacgagcacatgcctatt
gaagcgcccccggtcatcagtggggttcagtctggtttgcagatgtatgggctctaccgg
ctcggacctgcgcaggtgcatcttctggacacccgtcagttccgcacaaaccagccctgt
ggtgatggccgaaaggtgtcttgcgaggaggcccttgatcctgcccagacgatgctcggc
ggtgatcaggagaagtggctatttcgggagctgacgcgctcgaacgcgccgttcaacctg
attgccacgcaggtctggttcacgccctatcgctacaatgcgccgcctgaagcgccgcag
atgaatttcgacagctgggatgggtacccgctggcgcggcaacgcttgtccgatgttctc
gcgcaaggcgtcaggaaccctgttttcctgaccggtgactggcatacggcaatggcatca
acggtttatcagacccccctggacacgcgttcaaaacggatcggacacgaacttgtcggc
gcttcgatttcgtctggctgtccctgggcaagagatatggaaatcatgcgggatgccaat
ccgcatgtcgctcatctcaacggcaacaagcgaggctatctccgggttacggtaaaaaaa
gacgactgtatcggagacttccgggtggtcgaggacgtcgggcgtgcaaactcggctgtc
acaagcgagttggaaatccatacaaaggacatctga

DBGET integrated database retrieval system