KEGG   Hyphomonas neptunium: HNE_2567Help
Entry
HNE_2567          CDS       T00397                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
hne  Hyphomonas neptunium
Pathway
hne00330  Arginine and proline metabolism
hne00332  Carbapenem biosynthesis
hne01100  Metabolic pathways
hne01130  Biosynthesis of antibiotics
hne01230  Biosynthesis of amino acids
Module
hne_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HNE_2567 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    HNE_2567 (proB)
Enzymes [BR:hne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     HNE_2567 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA IclR
Motif
Other DBs
NCBI-ProteinID: ABI77462
UniProt: Q0BZ34
Position
2720158..2721273
Genome map
AA seq 371 aa AA seqDB search
MTADTLSRAKRIVVKTGSALIAEAGAPRREWLAALAADIAALRQRGKEVILVSSGAVALG
RSALGAPYQGRLEQKQAAAAIGQPRLMAALGDALAPHAIACGQALLTPGDTENRRRWLNA
RATLETLLEAGVVPVINENDTVATEEIRYGDNDRLAARVAQMMAADVLILLSDIDGLYTA
DPRSNPGAPHIPFLEALTPEHDAMATGANAAAGVGSGGMATKLAAARIAHAAGCSTLITL
GNRPHPLGAIEAGERATLIASRISPAKARAAWLEGHLKPEGELLIDDGAAAALAKGASLL
AVGVRGVTGQFERGAAVAIRAPDGRIIAKGVTAYGTEDIRRIAGRRTEDAEAILGYRGRP
AIIHRDDMVRL
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgacaccctctcccgcgccaagcgcatcgtcgtgaaaaccggctctgccctc
atcgcggaggcaggcgctccgcgccgcgaatggctcgccgccctcgccgcagacatcgcc
gccctgcgccagcgcggcaaggaagtcatcctcgtctcctccggcgccgttgcccttggc
cgctcagccctcggcgcgccctatcaaggccgcctggaacagaaacaggccgccgccgcc
atcggccagccccggctcatggccgcgctgggagacgccctcgccccccacgccatcgcc
tgcggccaggccctcctcacccccggcgacaccgaaaatcgccgcagatggctgaatgcc
cgcgccacgctggaaaccctgctggaagccggtgtcgtccccgtcatcaacgagaacgat
accgtcgccaccgaagaaatccgctacggggataatgaccgcctcgccgcccgcgtcgcc
cagatgatggccgctgatgtcctgatcctcctctcggacatcgacggcctctacaccgca
gacccgcgctcaaaccccggcgccccccacatccccttcctcgaagcgctcacccctgag
catgacgccatggccaccggcgccaacgccgccgccggtgtcggctccggcggcatggcc
accaaactcgccgccgcccgcatcgcccatgcggcgggctgctccaccctcatcacgctc
ggcaaccgcccccaccccctcggcgccatcgaggccggcgaacgcgccaccctcatcgcc
tcccgcatcagccccgccaaggcccgcgccgcctggctcgaaggccacctcaagcccgaa
ggcgaactcctcatcgatgacggcgccgccgccgcgctggcaaaaggcgcgagcctcctc
gccgtcggcgtgcgcggcgtcaccggccagttcgagcgcggcgccgccgtcgccatccgc
gcccccgatggccgcatcatagccaagggcgtcaccgcctacggcaccgaagacatccgc
cgcatcgccggccgccgcaccgaagacgccgaagccatcctcggctatcgcggccgcccc
gccatcatccaccgcgacgacatggtgcgcctttga

DBGET integrated database retrieval system