KEGG   Hyphomonas neptunium: HNE_3064Help
Entry
HNE_3064          CDS       T00397                                 

Definition
glutathione peroxidase (EC:1.11.1.-)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
hne  Hyphomonas neptunium
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    HNE_3064
  Metabolism of other amino acids
   00480 Glutathione metabolism
    HNE_3064
Enzymes [BR:hne01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     HNE_3064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3239431..3240036
Genome map
AA seq 201 aa AA seqDB search
MRLAILALAAPFLAAACAEATAGQPTANAPAAPTEFQAEEPAPAMSATQFTSITGQPLDL
TALGAKAILVVNTASRCGYTPQYAGLQKLYEANKADGLVIVGVPSNDFGGQEPGTEEDVK
SFCEINYGVTFPLTKKYAVTGASQHPFYTGAIKTLGDPALPKWNFHKILVSADGTPLKAY
ASSVKPDDSGLAADIEAALGI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgccttgcgatccttgcccttgccgccccctttctggcggccgcctgcgctgaggca
acggccggccagcccacggccaacgcccctgctgctccaacagaattccaggccgaggag
cccgcgcccgccatgtccgccacccagttcaccagcatcaccggccagccgctcgacctc
accgccctcggcgcgaaggccatcctggtggtaaacaccgcctcgcggtgcgggtacacg
ccccaatatgccggcctccagaaactctacgaagccaacaaggcggacggcctggtgatc
gtcggcgtcccgtccaatgattttggcggacaggagccaggcaccgaagaggacgtcaaa
tccttctgcgagatcaattacggcgtcaccttcccgctgacgaagaagtacgccgtcaca
ggcgcgtcgcagcaccccttctataccggcgccatcaagacgctgggcgatcccgccctg
ccgaaatggaacttccacaaaatcctcgtcagcgcagatggcacgccgctcaaggcctat
gcgtcttcggtaaagcccgatgactccggcctcgccgccgacatcgaagcagcgctcggc
atctga

DBGET integrated database retrieval system