KEGG   Hyphomonas neptunium: HNE_3064Help
Entry
HNE_3064          CDS       T00397                                 

Definition
(GenBank) glutathione peroxidase family protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
hne  Hyphomonas neptunium
Pathway
hne00480  Glutathione metabolism
hne00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    HNE_3064
  Metabolism of other amino acids
   00480 Glutathione metabolism
    HNE_3064
Enzymes [BR:hne01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     HNE_3064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ABI75895
UniProt: Q0BXQ3
Position
3239431..3240036
Genome map
AA seq 201 aa AA seqDB search
MRLAILALAAPFLAAACAEATAGQPTANAPAAPTEFQAEEPAPAMSATQFTSITGQPLDL
TALGAKAILVVNTASRCGYTPQYAGLQKLYEANKADGLVIVGVPSNDFGGQEPGTEEDVK
SFCEINYGVTFPLTKKYAVTGASQHPFYTGAIKTLGDPALPKWNFHKILVSADGTPLKAY
ASSVKPDDSGLAADIEAALGI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgccttgcgatccttgcccttgccgccccctttctggcggccgcctgcgctgaggca
acggccggccagcccacggccaacgcccctgctgctccaacagaattccaggccgaggag
cccgcgcccgccatgtccgccacccagttcaccagcatcaccggccagccgctcgacctc
accgccctcggcgcgaaggccatcctggtggtaaacaccgcctcgcggtgcgggtacacg
ccccaatatgccggcctccagaaactctacgaagccaacaaggcggacggcctggtgatc
gtcggcgtcccgtccaatgattttggcggacaggagccaggcaccgaagaggacgtcaaa
tccttctgcgagatcaattacggcgtcaccttcccgctgacgaagaagtacgccgtcaca
ggcgcgtcgcagcaccccttctataccggcgccatcaagacgctgggcgatcccgccctg
ccgaaatggaacttccacaaaatcctcgtcagcgcagatggcacgccgctcaaggcctat
gcgtcttcggtaaagcccgatgactccggcctcgccgccgacatcgaagcagcgctcggc
atctga

DBGET integrated database retrieval system