KEGG   Hyphomonas neptunium: HNE_3064Help
Entry
HNE_3064          CDS       T00397                                 

Definition
glutathione peroxidase (EC:1.11.1.-)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
hne  Hyphomonas neptunium
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:hne00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:hne00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3239431..3240036
Genome map
AA seq 201 aa AA seqDB search
MRLAILALAAPFLAAACAEATAGQPTANAPAAPTEFQAEEPAPAMSATQFTSITGQPLDL
TALGAKAILVVNTASRCGYTPQYAGLQKLYEANKADGLVIVGVPSNDFGGQEPGTEEDVK
SFCEINYGVTFPLTKKYAVTGASQHPFYTGAIKTLGDPALPKWNFHKILVSADGTPLKAY
ASSVKPDDSGLAADIEAALGI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgccttgcgatccttgcccttgccgccccctttctggcggccgcctgcgctgaggca
acggccggccagcccacggccaacgcccctgctgctccaacagaattccaggccgaggag
cccgcgcccgccatgtccgccacccagttcaccagcatcaccggccagccgctcgacctc
accgccctcggcgcgaaggccatcctggtggtaaacaccgcctcgcggtgcgggtacacg
ccccaatatgccggcctccagaaactctacgaagccaacaaggcggacggcctggtgatc
gtcggcgtcccgtccaatgattttggcggacaggagccaggcaccgaagaggacgtcaaa
tccttctgcgagatcaattacggcgtcaccttcccgctgacgaagaagtacgccgtcaca
ggcgcgtcgcagcaccccttctataccggcgccatcaagacgctgggcgatcccgccctg
ccgaaatggaacttccacaaaatcctcgtcagcgcagatggcacgccgctcaaggcctat
gcgtcttcggtaaagcccgatgactccggcctcgccgccgacatcgaagcagcgctcggc
atctga

DBGET integrated database retrieval system