KEGG   Hyphomonas neptunium: HNE_3136Help
Entry
HNE_3136          CDS       T00397                                 

Definition
fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
hne  Hyphomonas neptunium
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:hne01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:hne01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3315057..3315947)
Genome map
AA seq 296 aa AA seqDB search
MIPRSAAIPKNWKTFDIPSFFSAFGYPAIGIGLFTTMILLGIFVSELTFHWWYLPIAFGV
VAFSVFWCNLGIGPMHRILQHRAGEMKWPAQVLTMLNIIIAMQGNLRDWVNYHSQHHRFA
DGPGDPHNPFESKRWAWVGWILFRDRKDTARPMAAWLKQHPVIVWMDRFYNEISIVIHFV
IPAVIYLIVWAAGGSLVLTALLHASVIIGRAIQFHATVYGINVLGHLKTPVWADHLMALL
TGGEAFHDHHHDEPQSALHRPRKGVWNRIVDYNGTVLLLLEKIGWVKDLKIAPRFA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgattccgcgttccgccgcgatcccgaaaaactggaaaactttcgacatcccgagcttc
ttctcggcctttggctatcccgcaatcgggatcggcctgttcaccaccatgatattgctg
ggcatctttgtcagcgagctgaccttccactggtggtatctgccgattgccttcggggtg
gtcgctttctctgtcttctggtgcaatctgggcattgggccaatgcaccgcatcctgcaa
catcgcgccggagagatgaaatggcccgcccaggtgctgaccatgctcaacatcattatc
gccatgcagggcaatctgcgtgactgggtgaattatcactcacagcaccaccgcttcgcc
gacgggccaggcgatccgcacaatcccttcgagtccaaacgctgggcctgggttggctgg
atcctgttccgcgaccggaaagataccgcccgcccgatggccgcctggctgaagcagcat
ccggtgatcgtctggatggaccggttttataacgagatcagcattgtcatccatttcgtc
attccggcggtcatctatctgatcgtgtgggcggcgggagggtctctggtccttacggcg
ctgctgcacgcaagtgtcatcatcggccgcgctatccagttccacgcgactgtctatggc
atcaacgtgctgggccatttgaaaacgccggtctgggcagatcatttgatggcgctgctg
acaggcggggaagccttccacgatcatcaccatgacgagccccagagcgcgctacaccgg
ccgcgcaagggtgtctggaatcgtatcgttgactataacggcacagtgctgctgcttctg
gaaaagatcggctgggtgaaagacctcaagatcgcgccacggttcgcctga

DBGET integrated database retrieval system