KEGG   Hyphomonas neptunium: HNE_3203Help
Entry
HNE_3203          CDS       T00397                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
hne  Hyphomonas neptunium
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hne00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3376545..3377165
Genome map
AA seq 206 aa AA seqDB search
MDAVTPKKDIPRPDSVRRPSQQEAEEAVRTLIAWAGDDPAREGLIDTPKRVVNAYKEWFE
GYGEDPVKYLSRTFEDVQGYDDIVMLRNIEVESHCEHHIAPFIGKAFIAYKPSTAVVGIS
KLARVVEIFAKRLQTQETMTAQICDAITESLAPMGTAVFIEAEHQCMSTRGVHHKHVTTI
TTQFTGVFKSDADLRNRFLNMCGQTV
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggacgccgttactccaaaaaaagacattccgcgcccggattccgtgcgccgcccctct
caacaggaagccgaagaagccgtgcgcacgctcatcgcgtgggcaggggatgatccggcc
cgtgaaggcctgatcgacacgcccaagcgcgtcgtcaacgcctataaagagtggtttgaa
ggctatggcgaagacccggtaaaatatctcagccggaccttcgaggatgtgcagggctat
gacgacatcgtcatgctgcgcaacatcgaggtggaaagccattgcgagcaccatatcgcg
cccttcatcggcaaggcgttcatcgcctataagccgtcgacggcggttgtgggcatttca
aagcttgcccgcgtggtcgagatcttcgccaagcgcctgcagacgcaggaaacgatgacg
gcgcagatttgcgatgccatcaccgaaagcctagcgccaatgggaacagccgtgttcatc
gaagccgagcatcagtgcatgtccacccgcggcgttcaccacaagcatgtgaccacgatc
accacgcagtttaccggcgtgttcaaatccgatgcggatttgcgcaaccggttcctgaac
atgtgcggccagacggtctga

DBGET integrated database retrieval system