KEGG   Hyphomonas neptunium: HNE_3238Help
Entry
HNE_3238          CDS       T00397                                 

Definition
putative phosphoglucomutase/phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hne  Hyphomonas neptunium
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HNE_3238
   00030 Pentose phosphate pathway
    HNE_3238
   00051 Fructose and mannose metabolism
    HNE_3238
   00052 Galactose metabolism
    HNE_3238
   00500 Starch and sucrose metabolism
    HNE_3238
   00520 Amino sugar and nucleotide sugar metabolism
    HNE_3238
  Nucleotide metabolism
   00230 Purine metabolism
    HNE_3238
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HNE_3238
Enzymes [BR:hne01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HNE_3238
    5.4.2.8  phosphomannomutase
     HNE_3238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3405496..3407013)
Genome map
AA seq 505 aa AA seqDB search
MFPKPLADIAPNTLEFEVLPLVKPTGFREYDARWWFNGIGHAKPAELNLTGVQALGLGMA
TLFHELGVKPTVVTGHDYRSISQPIKNALTLGLMAGGCEVLDVGLALSPMVYWSQFELDA
ACCAMVTASHNENGWTGVKMGADRPLTFGPDEMGRLKEIVMGGKFVTREGGTHRRIDGIR
EKYIKAVVGDTKLTRKLKVVAACGNGTAGAFAGDVLRAIGADVIEMDCNLDMTFPKYNPN
PEDQEMLHAMAVTVKETGADLALGFDGDGDRCGVVDNNGEEIYADKIGLMLARDLSKNFA
NAKFVVDVKSTGLYKTDPVLKANGATVDYYKTGHSYIKRRTNELGALAGFEKSGHFFFRP
PIGLGYDDGLIAAKAILEMLDRNPGKTMADLNGELGVAYTSLTMAAHCGDEVKYDVVDKM
VAEYQGLDGTMILGRKVVEVNTVNGARVTLEDGSWVLVRASSNKPELVVVVESMSSEADM
KDLFHKEVKPRLGKHAEVGKYNQEI
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgtttccaaaaccgctcgctgacatcgccccgaatacgcttgaattcgaggtgctgccc
ctcgtgaaaccgaccggcttccgggagtatgatgcgcgctggtggttcaacgggatcggg
cacgccaagccggccgagctgaacctgacgggcgttcaggcgctggggctggggatggcg
acgctgttccatgagctgggcgtcaagccgaccgtggtgacggggcatgactatcgctcg
atcagccagccgatcaagaatgcgctgaccctggggttgatggccgggggctgtgaggtg
ctggatgtgggcctggcgctctcgccgatggtctattggagccagtttgagctcgacgcg
gcgtgctgcgcgatggtgaccgcctcgcataacgagaatggctggacgggcgtgaagatg
ggcgccgaccggccgctgaccttcgggccggacgaaatgggccgcctgaaagagattgtc
atgggcggcaagttcgtcacccgtgagggcggcacgcaccgccgcatcgacggtatccgc
gagaaatatatcaaggctgtggtgggcgacacgaagctgacgcgcaagctgaaggtggtg
gctgcctgtggcaatggcacggcaggcgcctttgcgggcgacgtgctgcgcgcgattggc
gcggacgtgatcgagatggattgcaatctcgatatgaccttcccgaaatacaatccgaac
ccggaagatcaggaaatgctgcatgccatggcggtgaccgtcaaggaaaccggggcggat
ctggcgctcggctttgacggggacggggaccggtgcggcgtagtcgacaataacggcgag
gaaatctacgccgacaagattggcctgatgctggcacgcgacctgtcgaagaattttgcc
aacgcgaaatttgtggtcgatgtgaaatcgaccggcctctacaagaccgacccggtgctg
aaggccaacggcgcgacggtggattattacaagaccggccactcctacatcaagcgccgc
acaaatgagctcggcgcgctggcggggtttgaaaagtccggccacttcttcttccggccg
ccgattgggctgggctatgatgatgggctgattgcggccaaggcgatcctcgaaatgctg
gaccgcaaccccggcaagacgatggcggacctgaatggcgagctgggcgtcgcctacacc
tcgctgaccatggcggcccattgcggcgacgaggtgaaatatgatgtcgttgacaagatg
gttgccgaatatcagggcctcgatggcacgatgatcctggggcggaaggtcgtggaagtg
aatacggtcaacggcgcgcgggtgacgcttgaggatggctcctgggtgctggtgcgggcc
tcttcaaacaagcccgaactggtggtcgtggtggaatccatgagcagcgaagccgacatg
aaggacctcttccataaggaagtgaaaccgcgcctcggcaagcatgccgaagtgggcaaa
tacaatcaggaaatctga

DBGET integrated database retrieval system