KEGG   Hyphomonas neptunium: HNE_3244Help
Entry
HNE_3244          CDS       T00397                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
hne  Hyphomonas neptunium
Pathway
hne00020  Citrate cycle (TCA cycle)
hne00190  Oxidative phosphorylation
hne00650  Butanoate metabolism
hne01100  Metabolic pathways
hne01110  Biosynthesis of secondary metabolites
hne01120  Microbial metabolism in diverse environments
hne01130  Biosynthesis of antibiotics
hne01200  Carbon metabolism
Module
hne_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hne_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hne_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HNE_3244 (sdhD)
   00650 Butanoate metabolism
    HNE_3244 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    HNE_3244 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ABI77817
UniProt: Q0BX76
Position
3412923..3413312
Genome map
AA seq 129 aa AA seqDB search
MSEGQYVTPTKAARGLGSAKSGTQHHIRLRVTAIALAFLVPWCLYAVIKASGAGYEGALA
WVGQPINATLLILTAAAVSYHMRLGMQVIIEDYIAKTATRTTLLILNTFAAYAMFIAVAM
AVVQIWTAR
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaggccaatacgtcacccccaccaaggccgcacggggcctgggctctgccaag
tccggcacgcagcaccacatccgcctgcgcgtcaccgccatcgccctggcattcctggtg
ccctggtgcctctacgccgtcatcaaggcgtcgggcgcaggctatgaaggcgcgctcgcc
tgggtcggccagccgatcaacgccaccctgctgatcctgacagccgctgcggtatcttat
cacatgcgcctcggcatgcaggttatcatcgaagactacatcgccaagaccgccacgcgc
actaccctcctgatcctgaacacctttgccgcctatgcgatgttcatcgccgtcgccatg
gccgtggttcagatctggacggcacgctga

DBGET integrated database retrieval system