KEGG   Hyphomonas neptunium: HNE_3244Help
Entry
HNE_3244          CDS       T00397                                 

Gene name
sdhD
Definition
succinate dehydrogenase, hydrophobic membrane anchor protein (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
hne  Hyphomonas neptunium
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HNE_3244 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HNE_3244 (sdhD)
   00650 Butanoate metabolism
    HNE_3244 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    HNE_3244 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3412923..3413312
Genome map
AA seq 129 aa AA seqDB search
MSEGQYVTPTKAARGLGSAKSGTQHHIRLRVTAIALAFLVPWCLYAVIKASGAGYEGALA
WVGQPINATLLILTAAAVSYHMRLGMQVIIEDYIAKTATRTTLLILNTFAAYAMFIAVAM
AVVQIWTAR
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaggccaatacgtcacccccaccaaggccgcacggggcctgggctctgccaag
tccggcacgcagcaccacatccgcctgcgcgtcaccgccatcgccctggcattcctggtg
ccctggtgcctctacgccgtcatcaaggcgtcgggcgcaggctatgaaggcgcgctcgcc
tgggtcggccagccgatcaacgccaccctgctgatcctgacagccgctgcggtatcttat
cacatgcgcctcggcatgcaggttatcatcgaagactacatcgccaagaccgccacgcgc
actaccctcctgatcctgaacacctttgccgcctatgcgatgttcatcgccgtcgccatg
gccgtggttcagatctggacggcacgctga

DBGET integrated database retrieval system