KEGG   Hyphomonas neptunium: HNE_3284Help
Entry
HNE_3284          CDS       T00397                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase domain protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
hne  Hyphomonas neptunium
Pathway
hne00071  Fatty acid degradation
hne00280  Valine, leucine and isoleucine degradation
hne00281  Geraniol degradation
hne00310  Lysine degradation
hne00360  Phenylalanine metabolism
hne00362  Benzoate degradation
hne00380  Tryptophan metabolism
hne00410  beta-Alanine metabolism
hne00627  Aminobenzoate degradation
hne00640  Propanoate metabolism
hne00650  Butanoate metabolism
hne00903  Limonene and pinene degradation
hne00930  Caprolactam degradation
hne01100  Metabolic pathways
hne01110  Biosynthesis of secondary metabolites
hne01120  Microbial metabolism in diverse environments
hne01130  Biosynthesis of antibiotics
hne01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    HNE_3284
   00650 Butanoate metabolism
    HNE_3284
  Lipid metabolism
   00071 Fatty acid degradation
    HNE_3284
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HNE_3284
   00310 Lysine degradation
    HNE_3284
   00360 Phenylalanine metabolism
    HNE_3284
   00380 Tryptophan metabolism
    HNE_3284
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HNE_3284
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HNE_3284
   00281 Geraniol degradation
    HNE_3284
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HNE_3284
   00627 Aminobenzoate degradation
    HNE_3284
   00930 Caprolactam degradation
    HNE_3284
Enzymes [BR:hne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     HNE_3284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ABI78772
UniProt: Q0BX36
Position
complement(3446538..3447350)
Genome map
AA seq 270 aa AA seqDB search
MSAHYDITAEKWERFTFERKGRVLTAYITSDHPVNGVDEAMHTELALVFNCLQRDTDSDL
IILSAKGRAFCAGGDFDWFEEQIAHPERFRAIGWDAKQIVVTLLQMEKPVICRMNGAAAG
LGATIALLCDVIIADETAKIGDPHVKVGLVAGDGGALIWPQLIGFAKAKELLMTGDLLSA
PEAKALGLINYAVPAAELDAKVDEIVGKIMANPKWAVRWTKTTANIPLRALAAQMMDASI
GWESVSNYLGDRKEAVAAFKERRAAKLTGE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcattacgacatcacggcagaaaaatgggaacgtttcacctttgaacggaag
ggccgtgtgctgacggcctatatcacctccgatcatccggtgaacggcgtggacgaggcc
atgcacacagagctggcgcttgtgttcaactgcctgcaacgcgacaccgacagcgacctc
atcatcctttcggccaagggccgtgccttctgcgcgggcggggattttgactggtttgag
gaacagatcgcgcatcctgaacgcttccgcgccatcggctgggacgccaagcagatcgtg
gtgacgctgctccagatggaaaagccagtcatttgccggatgaatggcgcggccgcaggc
ctgggcgcgacgattgcgctgctgtgcgatgtgatcattgccgacgagacggccaagatc
ggcgatccgcatgtgaaggtcggcctggtggcaggcgatggcggcgcgctgatctggccg
cagctgatcggttttgccaaggccaaggaacttctgatgacgggcgacctgctgagtgcg
cccgaagccaaggcgctcggcctcataaattatgccgtgccggccgcagagctcgacgca
aaagtggacgagatcgtcggcaagatcatggccaacccgaaatgggcggtgcgctggacc
aagacgaccgccaacatccccctgcgcgcgctcgccgcgcagatgatggatgcgtccatc
ggctgggaaagcgtctcaaactatctgggcgaccggaaagaggccgtggccgctttcaag
gaacgccgcgcggcgaagctgacgggggagtga

DBGET integrated database retrieval system