KEGG   Hyphomonas neptunium: HNE_3376Help
Entry
HNE_3376          CDS       T00397                                 

Definition
phosphoribosyl-AMP cyclohydrolase (EC:3.5.4.19)
Orthology
K01496  
phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
hne  Hyphomonas neptunium
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HNE_3376
  Amino acid metabolism
   00340 Histidine metabolism
    HNE_3376
Enzymes [BR:hne01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     HNE_3376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3521179..3521574
Genome map
AA seq 131 aa AA seqDB search
MTPFPPPLSGSAQDETPELRPRFDENGLIAAIAQDAGTGEVLMLAWMNAEALQKTIETGR
ATYWSRSRGALWVKGETSGHTQEVIELRVDCDQDAVLLKVRQTGGACHTHRESCFYRRIE
GGVLSFTGKAD
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgttcccgccccccctctccggcagtgcccaggatgaaacgccggagcttcgc
ccgcgctttgacgagaacggcctcatcgccgccatcgcgcaggatgcgggcaccggtgag
gtgctgatgctcgcctggatgaatgccgaagcgctacagaaaacgatagagaccggccgg
gccacctactggtcgcgctcacgcggggcgctttgggtgaagggtgagacctccggccac
acgcaggaagtcatcgaactgcgcgtcgattgcgatcaggacgccgtactgctgaaagtg
cgccagacaggcggggcctgccacacccaccgggaaagctgcttctatcggcgcatcgaa
ggcggggtgctatccttcaccggcaaggcagattag

DBGET integrated database retrieval system