KEGG   Hyphomonas neptunium: HNE_3474Help
Entry
HNE_3474          CDS       T00397                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hne  Hyphomonas neptunium
Pathway
hne00260  Glycine, serine and threonine metabolism
hne00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hne01100  Metabolic pathways
hne01110  Biosynthesis of secondary metabolites
hne01130  Biosynthesis of antibiotics
hne01230  Biosynthesis of amino acids
Module
hne_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HNE_3474 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HNE_3474 (trpA)
Enzymes [BR:hne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HNE_3474 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB BtpA
Motif
Other DBs
NCBI-ProteinID: ABI76500
UniProt: Q0BWJ7
Position
complement(3610008..3610835)
Genome map
AA seq 275 aa AA seqDB search
MGRERIEAAFAKAKGENRAALVTYLMAGDPSLEESYTAMCALRDNGADIIELGAPFTDPM
ADGPAIQRAGLRALANGTKLTDVLALAARFRKDDQTTPLILMGYANPIHSMGYEVFAEAA
ADAGIDGSIIVDLPPEEDAGLREIYSKRGLSVIRLATPTTDEARAAKVADGASGFIYFVA
VTGVTGSGSADPAAIAGKVAMVRKVSGLPVCVGFGVKNGAQAVEMAKIADGVVVGSAFVE
KAQDAHESGKFETAAPAMGELAGELRRALAGVSKG
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgggccgggaaagaattgaagccgccttcgccaaagcgaagggcgaaaaccgggctgcg
cttgtcacctatctgatggcgggcgatccgagccttgaagagagctatacggcgatgtgc
gcgctgcgtgacaatggcgctgacattatcgagctgggcgcgccgttcaccgatccgatg
gcggatggcccggccatccagcgggcgggccttcgcgcgctggccaacggcacgaagctg
accgatgtgctggcgctggctgcgcgtttccggaaggatgatcagacgacgccgctgatc
ctgatgggctatgccaatccgatccattccatggggtatgaggtttttgccgaggccgcc
gcggacgccgggattgatggctcgatcatcgtggaccttccgcccgaggaagatgcgggt
ctgcgcgagatctacagcaagcgcggtctttcggtgatccgcctggcgacgccaacgacc
gacgaggcgcgcgctgcaaaggttgccgatggggcgtcgggctttatctactttgtagcg
gtgacgggtgtgacggggtcgggaagcgctgatcctgcagccattgctgggaaagtggcg
atggtccggaaggtgtccggtttgccggtttgtgtcggttttggtgtaaaaaatggtgca
caagccgtagaaatggctaagattgccgacggggtggtggttggttcggcttttgtggaa
aaggcgcaggatgcgcatgaatctgggaagtttgagacggcggcacccgcaatgggcgag
cttgcaggagaactgcgccgcgcgctcgcaggcgtgtccaaaggctga

DBGET integrated database retrieval system