KEGG   Hyphomonas neptunium: HNE_3476Help
Entry
HNE_3476          CDS       T00397                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hne  Hyphomonas neptunium
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HNE_3476 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HNE_3476 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HNE_3476 (trpB)
Enzymes [BR:hne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HNE_3476 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3611155..3612366)
Genome map
AA seq 403 aa AA seqDB search
MDLRNTWDQWPDANGRFGEFGGRYVAETLMPLILDLEREYRAAKQDPAFKAEMDDLWAHY
VGRPSPLYFAERLTEHFGGAKIYFKRDELNHTGAHKINNCLGQVLLARRMGKKRIIAETG
AGQHGVATATICARFGLDCVVFMGETDVERQKPNVFRMRLLGAQIVPVSSGTGTLKDAMN
EALRDWVTNVDDTFYCIGTAAGPHPYPEMVRDFQSIIGKEARAQILEREGRLPDAVMACI
GGGSNAIGLFHPFIEDEGVRLIGVEAAGHGIETGEHAAALNGGKPGILHGNRTYLLQTDD
GQIIDAHSISAGLDYPGIGPEHAFLRDAGRAEYLSCTDKEALDAFQLCTRLEGIIPALEP
SHAIARVGEVAKDLGKDGLLILNMCGRGDKDVFSVAKALGVDV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcgcaatacctgggatcaatggccggacgcaaatggccggtttggtgaattt
ggcggacggtatgtggccgagacgctgatgccgctgatcctggatctggagcgtgaatat
cgcgcggccaagcaggacccggctttcaaggcggagatggacgatttgtgggcccattat
gtgggccgcccgtcgccgctgtatttcgctgagcgcctgaccgagcatttcggcggagcg
aaaatctatttcaaacgcgatgagctcaatcacaccggcgcgcacaagatcaacaactgc
ctgggtcaggtgctgctggcgcggcggatgggcaagaagcgtatcattgccgaaaccggc
gcgggccagcacggcgtggcaacagccacgatctgtgcccgctttggcctcgattgcgtg
gtgttcatgggcgagaccgatgtggagcgccagaaacccaacgtgttccggatgcgcctt
ctgggcgcgcagattgttccggtttcctcaggcacgggcacgctgaaagatgcgatgaac
gaagccctgcgcgactgggtgacgaatgtggatgacaccttctattgcatcggcacggcg
gccggcccgcacccctatccggagatggtgcgtgatttccagtccatcatcggcaaggaa
gcgcgcgcgcagattctcgagcgggaagggcgcctgccggacgctgtgatggcgtgcatc
gggggcggctccaacgcgattggcctcttccatcctttcatcgaggatgagggcgtgcgc
ctgattggcgtggaagcggccgggcatggcatcgagaccggagagcatgccgctgcgctg
aacggtggcaagcccggcatcctgcatggcaaccggacatatctgctgcagaccgatgat
ggtcagatcattgacgcgcattcgatttcggcaggcctggattatcccggcattggcccg
gagcacgccttcctgcgcgatgcgggaagggctgaatatctgtcgtgtacggacaaggag
gcgcttgatgcgttccagctctgcacgcggcttgaaggcatcattccggcgctggagcct
tcgcacgcgatcgcgcgggtcggcgaggtggcaaaggatctgggcaaggacggcctgctg
atcctcaacatgtgcgggcgcggggacaaggatgtgttctccgtcgccaaggcgctggga
gtggatgtatga

DBGET integrated database retrieval system