KEGG   Hyphomonas neptunium: HNE_3501Help
Entry
HNE_3501          CDS       T00397                                 

Gene name
phoD2
Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
hne  Hyphomonas neptunium
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HNE_3501 (phoD2)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    HNE_3501 (phoD2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HNE_3501 (phoD2)
Enzymes [BR:hne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     HNE_3501 (phoD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3637362..3639047
Genome map
AA seq 561 aa AA seqDB search
MVQVTRRSLLGGAALGTVALAACGTTGPQTYKGEAAFNHGVASGDPLPDRMILWTRVTPL
SGAGPIPVRWEVLRAGQDTPVSTGVTEATEAKDYCVKVDAAGLQPGSDYTYRFTAMTDHG
NVVSPEGRLRTPAASGTTAVNLAVVSCSNWQFGLFNAYKAIAAEPGLDAVVHLGDYIYEY
GIDGYGGDIAQKIGRLHEPSTEIVSLADYRRRHAQYKTDPDLQAAHAAAPWICTWDDHES
TNNAYRTGAENHNPENGEGEWSDRKMAAVQAYFEWMPIRDIKPGEVTSAAWRSFRFGDVA
TLHALESRLTGRSDELSWGDALAGAASPQDAMAKAQQTMQAAADPSRTMLGAEQEAWLNG
ELANSVASGAAWQVLANQVIMARVKLPDFSKLLTPEQMAAQDNPQVNAFLAFTALGLPFN
LDAWDGFPAARERLYESVSSAGARLVTLTGDTHTAWANELFDASEQRRGIEIGCTSISSP
GMGAYVKDVPDLGEQIADANKDVVWHDPFGHGYTMVTLTPSTARAVFRKVSDILAGTFST
ETVATFEASAEAGGVSALKAV
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggtacaggtaacacgtcgcagccttctgggcggagcagcattgggcacggtggcgctg
gccgcttgcggcacaacgggcccgcagacttataaaggcgaagccgccttcaatcacggg
gtggcctctggcgaccccctgcccgaccggatgatcctctggacccgcgtgacgccgcta
tcgggcgccgggccgatccctgtgcgctgggaagtgctgcgcgccgggcaggacacgccc
gtttccaccggcgtgaccgaggcgaccgaagcaaaggattactgcgtcaaggtggacgct
gccggcctgcagccgggctctgactatacctatcgcttcaccgcaatgaccgatcacggc
aatgtggtctcacccgaagggcgcctgcgcaccccggcggcaagtggcacgaccgcggtg
aacctggcggttgtctcctgctccaactggcagttcggcctgttcaacgcctataaggcg
attgccgccgaacccggtctcgacgcggtcgtccatctgggcgactatatctacgagtat
ggcattgacggctatggcggagacatcgcccagaagatcggccgcctgcatgaaccgtcc
acggagattgtatcgctggccgattaccgccgccggcatgctcagtacaagaccgatccc
gaccttcaggccgcccacgccgccgcgccctggatctgcacctgggacgaccatgaaagc
accaacaacgcctatcgcaccggcgcagaaaaccacaatccggagaatggcgaaggcgaa
tggagcgaccggaagatggccgccgtgcaggcctatttcgaatggatgccgatccgcgac
atcaagccgggcgaagtgacgtctgcggcctggcgcagcttccgctttggcgatgtggcg
acgctgcacgcgctggaatcgcgtctgaccggacgctccgacgagctgagctggggcgac
gcgctggctggcgcggcttctccgcaggacgccatggcgaaggcccagcagacgatgcag
gcagccgccgacccgtcgcgcacgatgctgggcgccgagcaggaagcctggctgaacggc
gagttggcaaactcggtagcctcgggcgcggcctggcaggttctggccaatcaggtgatc
atggcgcgcgtgaaactgccggatttctccaagcttctgacgcctgagcagatggcggcg
caggacaatccgcaggttaacgcgttcctcgccttcacggcgctgggcctgccgttcaac
ctggacgcctgggacggcttcccggcggcgcgcgagcggctgtatgagagcgtgagcagc
gcgggcgcgcggcttgtgacgctgacgggcgacacgcacactgcctgggcgaacgagctg
tttgatgcgagcgagcagcgccggggcatcgagatcggctgcacgtcgatctcctcgccc
ggcatgggcgcttatgtgaaggatgtgccggatctgggcgagcagattgcagacgccaac
aaggacgtcgtctggcacgatccgttcgggcacggatatacgatggtgacgctgacgccg
tcgaccgcgcgcgccgtgttccgcaaggtgtcggacatccttgccggtacattcagcaca
gagacggttgccaccttcgaggccagtgctgaagcgggcggggtctcggcgctgaaggca
gtctag

DBGET integrated database retrieval system