KEGG   Hyphomicrobium nitrativorans: W911_10425Help
Entry
W911_10425        CDS       T02943                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
hni  Hyphomicrobium nitrativorans
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hni00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    W911_10425
   00650 Butanoate metabolism
    W911_10425
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    W911_10425
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    W911_10425
Enzymes [BR:hni01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     W911_10425
Amino acid related enzymes [BR:hni01007]
 Aminotransferase (transaminase)
  Class III
   W911_10425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2171117..2172412)
Genome map
AA seq 431 aa AA seqDB search
MTTNAELHARRLAAVPRGIGNVTEIYPKRALNAEIWDEDGKRYIDFGAGIAVVNTGHQHP
RIQAAITEQMAAFSHVCFQVTPHENYVTLAERLNAIAPVSGPAKTMLASTGAEAVENAVK
VARCFTGRPGIVSFSGGFHGRTHMGMALTGKAVPYKKGFGPFPADIYNVAFPNLYHGTST
AESIKALKALFKYQADPSTIAGIVIEPVQGEGGFNIAPFEFLAELRALCDEHGIVLIADE
IQTGFARTGQMFALDHAGVKADVVTLAKGLAGGMPLSAIVGRADIMDASPPGGLGGTYAG
NPVAVAAAHAVLDVIADEDLCARANAIGTIIQNRSRDLAARSNLNCIGDVRGLGAMCAVE
FVKDRTSNSPWPELTAEVLKAGTVRGLILLSCGTYGNVIRFLPPLTASDALIEEGMDIFE
ASLTEAVAKLQ
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccaacgccgagcttcacgcacgccgtctcgccgctgtcccgcgcggcatcgga
aacgtcacggagatttatccgaagcgcgcgttgaacgcggagatctgggacgaggacgga
aagcgctacatcgatttcggcgcgggcatcgccgtcgtcaacaccggccaccagcatccg
cgtattcaagccgcgataaccgagcagatggcagccttcagccatgtctgcttccaggtc
acgccgcacgaaaactatgtcacgctcgcagagcggctcaacgccatcgcgccagtatcg
ggcccggcaaaaaccatgctcgcgtccaccggcgccgaagccgtcgagaacgcggtcaag
gtcgcgcgctgctttacagggcggcccggcatcgtctcgttttcaggcggcttccacggc
cgcacgcacatgggaatggcactgaccggcaaggccgtgccttacaagaagggcttcggc
cccttcccggccgacatctacaacgtcgcgttcccgaacctctatcacggcacgtcgacg
gcggagagcatcaaggcgctgaaggcgctcttcaagtatcaggcggatccctcaaccatc
gccggcatcgtcatcgagccggtgcagggcgaaggcggtttcaacatcgcgccgttcgaa
ttcctcgccgagctgcgcgcgctgtgcgacgagcacggcatcgtcctcatcgccgacgag
atccagaccggcttcgcgcgcaccggccagatgttcgcgctcgatcatgcgggcgtcaag
gcggacgtcgtcacgctcgcgaaaggtctcgccggcggcatgccgctctcggccatcgtc
ggccgcgccgacatcatggacgcctcgcctcccggcggcctcggcggaacctacgccggc
aatcccgtcgcggtcgcggccgcccacgccgtgctcgacgtcatcgcggacgaagacctc
tgcgcccgcgccaacgccatcggaaccatcatccagaaccgaagccgcgacctcgccgcc
cgctccaacctcaactgcatcggagacgtgcgcggcctcggcgccatgtgcgcggtcgag
ttcgtgaaggatcgcacgagcaactcgccctggcccgaactcaccgccgaagtgctgaaa
gccggcaccgtccgcgggctcatccttctgtcgtgcggaacctacggcaacgtcatccgc
ttcctgccgcccttgaccgcgagcgacgcgctcatcgaggaaggcatggacatcttcgaa
gcgagcctcaccgaggccgtcgccaagcttcagtag

DBGET integrated database retrieval system