KEGG   Hyphomicrobium nitrativorans: W911_14835Help
Entry
W911_14835        CDS       T02943                                 

Definition
alpha/beta hydrolase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
hni  Hyphomicrobium nitrativorans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3073539..3074411)
Genome map
AA seq 290 aa AA seqDB search
MQSSERTFGTERGRVGVLLIHGLCGSPGEIRFVANGLVREGYEVVTPTLAGHGGSEADLV
ATTWQDWYASAEKGLEELHATCDTVIVGGLSTGAVLSLMLAARHPDKVQGVALYSPTLWL
SGRQVPWYVPLFRLIDSKKVANLFRFPVPVHVGIKDQRIRDFIRSAMASGGGTKAAQVST
PGGAVLERRRLADVVIRELDAVTQPVLIVHARDDDYAGLDNATYLQRKIAGPVDLVVLDD
SFHMVTIDRERHTVLARTAAFVARIAGAVAGRRDDASVENACAELVQSAA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcgagtgagaggacattcggaacggagcgaggacgcgtaggcgtgctgctcatc
catgggctctgcggctcgccgggtgagatccgcttcgtcgccaacggcctcgtcagggaa
ggctacgaggtcgtcaccccgacgctcgccggtcatggcgggagcgaggccgatctcgtg
gcgaccacctggcaggactggtacgcgagcgccgagaagggcctcgaagagctgcacgca
acctgcgacacggtgatcgtgggcgggctctccaccggtgccgtcctcagcctcatgctg
gccgcccgccaccccgataaagtccagggcgtggccctttattcgcccaccctgtggctg
agcggccgtcaggtcccctggtatgtgccgctgttccgcctgatcgacagcaagaaggtc
gccaacctgttccggtttccggtgccggtgcacgtcggcatcaaggaccagcgcatccgc
gactttatccgcagcgcgatggcgtccggcggcggaacgaaggcggcccaggtctcgacg
ccgggcggcgcggtgcttgagcgccgccgcctggccgatgtggtcattcgcgaactcgat
gcggtgacgcagcctgtcctgatcgtccatgcgcgcgacgacgactacgctggcctcgac
aacgccacgtatctgcaacgcaagattgcaggccccgtcgatctcgtggtgctcgacgac
agctttcatatggtgaccatcgaccgggagcggcacaccgtgctggcgcgcacggcggcc
ttcgtggcgcggatcgcgggagccgttgcaggacgccgcgatgacgcgagtgtcgagaac
gcctgtgccgaactggtccagtcggcagcctga

DBGET integrated database retrieval system