KEGG   Hyphomicrobium nitrativorans: W911_15820Help
Entry
W911_15820        CDS       T02943                                 

Definition
phosphoenolpyruvate carboxylase
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
hni  Hyphomicrobium nitrativorans
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hni00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    W911_15820
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    W911_15820
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    W911_15820
   00680 Methane metabolism
    W911_15820
Enzymes [BR:hni01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     W911_15820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3290618..3293470
Genome map
AA seq 950 aa AA seqDB search
MSKTRSAGSATLDEQALRSELKELRAQIPDRPALNPIAHLAFRLSRQLEAGDISFDDLKD
LATRLMDSACVHRALVLKEQIGLESDEETDEEFSGFIANHAKDTSDAGFEAFQKRFGRAR
NGIVFTAHPTFGLSEELSNRIAEIAVSGSCDGKPLGIPHRPDPNLTLDYERGRVQSAIRN
LRDAYTDVLGDFFTTAHAAYGERAFKLKPQLATFASWVGYDLDGRTDINWAFSFTVRLRE
KADALADIRERFLALKEALGDEPEMVRLQRQVTGKLDLAIAAVESHIKALEAVGPEGKTL
ADAANVISQSDQHNLTSVEPLLALFDQVVETTSDVKAKVAVLSVAGLLRATGLGMSHIHV
RVNAVQINNAFRAFVHESWTRDLTERQAQARIVEMIDNVTPETVNFETLDLENATAIRQF
ALVAQIMKHVDCDTPIRYLIAECESPHTILIALYFAKLFGVSDIVDISPLFETPAALETG
QRLVERLLTVQAYRDHVTKRGRIAVQTGYSDAGRFIGQIAAGLAHERLHHGLAEVVRRSG
LKDVETLIFSTHGESMGRGAHPGNLRRRLRYVLPGESRWRFFRAGLPVKHETSFQGGDGY
LYFANTSFAKRALATIVMSGKDPGAGEDPFYTDTNLALDFQLRLRDYQQQLFAHPGYRAL
LGAFGANLLFKTGSRPVKRQGDHHSDRGDPARMRAIPNNAILQQFGYVANVVAGLGAGVG
SERERFIELAKQSQRLRSLIEMIARAKQLSSLYGVGANAVIFDPGFWAQRASWGRETHLD
GAFKFLAEHLLEDDRAGQIIGLAHFLRLDAIELHSILEEIGLEGGKIPDDHRLELDLLQA
IRATLIMRIFILTAQLPRFTPTNEVTHEEIVNKALGLEIPAVLQVVRQAFPRRVDDTRDD
DAFAEQATYLPKGIDDYGRIETEILDPMEQAYELVREIGTGISHHWGAFG
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagacgcggtccgcgggcagcgctacactggacgaacaggcccttcgcagcgaa
ctgaaagagctacgggcacagatccccgatcggcctgcactaaacccgatcgcgcatctg
gccttcaggctgtcgcggcagctcgaagccggcgacatcagcttcgacgatctgaaggat
cttgcaacgcgcctcatggacagcgcctgcgtgcaccgcgcgctcgtgctcaaggagcag
atcggcctcgaaagcgacgaggagaccgacgaggaattctcgggcttcatcgcaaaccac
gcgaaggatacgagcgatgcgggcttcgaggcgtttcagaagcgcttcgggcgtgcgcga
aacggcatcgtgttcacggcgcatcccactttcggcctctcggaggaactgtcgaaccgg
atcgcggaaattgccgtctccggctcttgcgacggcaagccgctcggcatcccgcaccgt
cccgatcccaatcttacgctcgattacgagcgcggccgcgtacagagcgcgatccgcaat
ctgcgcgacgcttatacggacgtgctgggcgactttttcaccacggcgcacgctgcgtat
ggcgagcgggcattcaagctgaagccacagctcgcgacgttcgcgtcgtgggtgggttac
gacctcgatggacgaaccgacattaactgggcgttctcgttcaccgtcaggctcagggaa
aaggccgatgcgcttgcggacatccgcgagcggttcctcgcgctcaaggaggctctcggc
gacgagccggagatggtgcggcttcagcgccaggtcaccggcaagctcgatctcgcgatc
gcggcagtcgaatcgcacatcaaggcgctcgaagcggtcggccccgaaggcaagaccctg
gccgatgccgccaacgtcatttcgcagtccgaccagcacaatctcacgagtgtcgagccg
ttgctcgcgctgttcgaccaggttgtcgaaaccaccagcgatgtgaaagcgaaggtcgcg
gtgctttcggtggcggggctcctgcgcgccaccgggctcggcatgagccacattcatgtg
cgcgtcaacgccgtgcagatcaacaacgcgttccgcgccttcgtgcacgagagctggacg
cgcgatctgaccgagcggcaggcgcaggcgcggatcgtcgagatgatcgacaacgtgacg
ccggagacggtcaacttcgagacgctggatctcgaaaacgcgacggccatccgccagttt
gcgctcgttgcgcagatcatgaagcatgtcgattgcgacacgccgatccgctacctgatc
gcggaatgcgaaagcccgcacacgatcctgatcgcgctttacttcgccaagctgttcggc
gtgtccgacatcgtcgacatctcgccgctgttcgagacgccggccgcactcgaaacgggg
cagcgcctcgtcgagcgcctgctcaccgtgcaggcgtatcgcgaccacgtgacgaagcgc
ggacgcattgcggtgcagacgggctattcggatgccggccgatttatcggccagatcgcc
gccgggctcgcgcacgagcggctgcatcacgggctcgccgaggtcgtgcgcaggtccggc
ctcaaggacgtggagacgctgattttttccacgcacggcgaaagcatggggcgcggcgcc
catccgggcaatctccggcggcgcctgcgttacgtgttgcccggcgaatcccggtggcgc
ttcttccgtgccggactgccggtgaaacacgagacgagcttccagggcggcgacggctat
ctctatttcgcgaacacgtccttcgcgaagcgggcgctcgccaccatcgtgatgagcggc
aaggatcctggcgcgggcgaggacccgttctataccgacaccaatctggcgctcgacttc
cagctccggctgcgcgactaccaacagcagctcttcgcgcatcccggataccgcgctctt
ctcggtgcattcggcgcgaacctgctgttcaagacgggctcccggcccgtcaaacgacag
ggcgatcaccattccgaccgcggcgaccctgcgcgcatgcgggctattccgaacaacgcg
atcctgcagcagttcggatatgtcgcgaacgtcgtggcggggcttggcgcaggcgtcggc
agcgaacgcgagcggttcatcgagcttgcgaagcaatcgcagcggctgcgctcgctgatc
gagatgattgcacgcgcgaagcagctttcgagcctctatggcgtcggcgccaacgcggtc
atcttcgatcccgggttctgggcacagcgtgcctcgtgggggcgcgagacgcatctcgac
ggcgcgttcaagttcctcgccgagcacctgctcgaagacgatcgggccggtcagatcatc
ggacttgcgcattttctccgtctcgacgccatcgagctgcacagcattctcgaagagatc
gggctcgaaggcgggaagatccccgacgatcaccgccttgaactcgatctcctgcaggcg
atccgcgcgacgctgatcatgcgcatcttcatcctcaccgcgcagctcccgcgctttacg
cccaccaacgaggtgacgcacgaggagatcgtgaacaaggcgctcgggctcgaaattccc
gccgtgctccaggtcgtgcgccaggcgttcccgcgtcgcgtcgacgacacgcgcgacgac
gatgccttcgccgagcaggcgacatacctgccgaagggcatcgacgattacgggcgtatc
gagaccgagattctcgatcccatggagcaagcctacgagctggtccgcgagatcggcacg
ggcatctcgcatcactggggcgcgttcggttaa

DBGET integrated database retrieval system