KEGG   Haliangium ochraceum: Hoch_0291Help
Entry
Hoch_0291         CDS       T01103                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hoh  Haliangium ochraceum
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hoh00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
424878..426368
Genome map
AA seq 496 aa AA seqDB search
MRYVVAIDQGTTGTTVLVLDRELHVVGRATREFPQVYPQPGWVEHDPEAIWNSVTESLGA
ALSDAGIRGEEVAALGITNQRETTVLWERASLRPVRNAIVWQDRRTAEMCARLKREGAEE
QVRAKTGLFFDPYFSGTKLRWMLDEDPTRRRGAEDGSLCFGTVDSYLVARLSDGGAHITD
VTNASRTLFMDLRTLDWDDELLAVLEVPRALLPEVRSSSEVYAETRGVPGLPDGIPIAGI
AGDQQAALFGQACYEAGAAKCTYGTGAFLLMNTGDEIVASKSGLVTTVAWKLGTGAEAGE
VRYALEGSAFVAGAVVQWLRDQLGFFSSAAEIEALAASVEDAGEVIVVPAHAGLGAPHWR
PDARGLITGLTRGSTRAHIARAALDGVALQNYDILKAMERDSGRELASLKVDGGASANDL
LMQFQSDVLGVSIARPEILETTALGSAFLAGLATSVWADKAEIAAAWREAKRFEPKADRT
VIDAHLERWNEAVAKA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacgtcgtcgccatcgatcagggaaccacgggcaccacggtgctggtgctcgac
cgcgagctgcacgtggtcggacgcgccacgcgcgaatttccccaggtctatccccagccc
ggctgggtcgagcacgaccccgaggcgatctggaactcggtgaccgaatcgctgggcgcg
gcgctgagcgacgccggcatccgcggcgaggaggtggcggccctgggcatcaccaaccag
cgcgagaccacggtgctgtgggagcgcgcgtcgctgcgtccggtgcgcaacgccatcgtc
tggcaggaccggcgcacggccgagatgtgcgcgcggctcaagcgcgagggcgccgaggag
caggtgcgcgccaagaccgggctgttcttcgatccctacttctcgggcaccaagctgcgc
tggatgctggacgaggacccgacgcggcgccgcggcgccgaggacggctcgctatgcttt
ggcaccgtggattcgtacctggtggcccggctcagcgacggcggcgcgcacatcaccgac
gtcaccaacgcctcgcgcacgctgttcatggacctgcgcacgctcgactgggacgatgag
ctgttggccgtgctcgaggtgccgcgcgcgcttctgcccgaggtccgcagctcgtccgag
gtgtatgccgagacccgcggcgtgcccggtctgcccgacggcatcccgatcgccggtatc
gccggcgaccagcaggccgcgctctttggccaggcctgctacgaggccggcgcggccaag
tgcacctacggcaccggcgcgttcctgctgatgaacacgggcgacgagatcgtggcctcg
aagtcgggcctggtgaccacggtggcgtggaagctcggcaccggcgccgaagccggcgag
gtccgctacgcgctcgagggctcggcctttgtcgccggcgcggtggtgcagtggctgcgc
gaccagctcggcttcttctccagcgccgccgagatcgaggccctggccgcctcggtcgag
gacgccggcgaggtcatcgtggtgcccgcccacgccggcctcggcgccccgcactggcgc
cccgacgcccgcggcctgatcacgggcctcacccgcggctcgacccgcgcgcacatcgcc
cgcgccgcgctcgacggcgtggccctgcagaactacgacatcctcaaagccatggagcgc
gactccgggcgcgagctggcgtcgctcaaggtcgacggcggcgcctcggccaacgacctg
ctcatgcagttccagagcgacgtgctcggcgtgagcatcgcgcgccccgagatcctcgag
accacggcgctgggctcggccttcctggccggtctggcgacctcggtgtgggccgacaag
gccgagatcgcggccgcctggcgcgaggccaaacgcttcgagcccaaggccgaccgcacc
gtgatcgacgcccacctcgagcgctggaacgaggccgtcgccaaagcctga

DBGET integrated database retrieval system