KEGG   Haliangium ochraceum: Hoch_0430Help
Entry
Hoch_0430         CDS       T01103                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
hoh  Haliangium ochraceum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hoch_0430
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Hoch_0430
Enzymes [BR:hoh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Hoch_0430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
591672..592829
Genome map
AA seq 385 aa AA seqDB search
MDTPTPPASAADAALSEDLSTRREVLGRARRVVVKVGSRLLAESPAARPALLADDIARQR
RGGERSFLVVSSGAVALGSRVLGFTERPRALPVLQAAAAVGQGKLLQHWEHAFAAHDVNI
AQLLLTHDDIADRSRFLNARHTLQALLEAGVVPVINENDSVAVEEIKYGDNDLLAALVSN
LVGADALLILTDVEGLRGADGVRMSLVRDIEREAVPVAKPPRADGVGSGGMASKVQAARA
AARSGVVTVVAPGRHPNVIDAVLGGDDVGTVFLPEAARMSSRKHWLAYGGKPVGRILVDE
GARRALVEGGRSLLPAGIIGVEGSFGLGDLVSLATAESGDFARGLVGYRSDDVSQLMGRQ
SSDIESTLGYKYLDAVMHRDDLVLL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggacaccccgacgccgcccgcgagcgccgccgatgccgcgctgagcgaggacctgagc
acccgccgcgaggtgctggggcgagcccggcgcgtggtcgtgaaagtcggcagccgcctg
ctggccgagagcccggcggcacggcccgcgctgctggccgatgatatcgcgcgccagcgc
cgcggcggcgagcgctccttcctggtggtcagctcgggcgcggtggccctgggctcgcgc
gtgctcggcttcaccgagcggccgcgcgcgctgcccgtgttgcaggccgcggccgcggtc
ggccagggcaagctcttgcagcactgggagcacgccttcgccgcgcacgatgtgaacatc
gcccagctcctgctcacgcacgacgacatcgccgatcgcagccgcttcctgaacgcgcgc
cacactttgcaggcgctgctcgaggccggcgtggtgcccgtgatcaacgagaacgactcg
gtcgcggtcgaggagatcaaatacggcgacaacgacctgctggcggcgctggtgagcaac
ctggtgggcgccgacgcgctgctgatcctcaccgatgtcgagggtctgcgcggggccgat
ggcgtgcgcatgtcgctggtgcgcgacatcgagcgcgaggccgtgcccgtggccaaaccg
ccgcgcgccgacggcgtcggctcgggcggcatggcgtccaaggtccaggcggcgcgggcc
gccgctcgcagcggcgtggtcaccgtggtcgccccaggccggcacccgaacgtgatcgac
gcggtgctcggcggcgacgacgtcggcaccgtgttcctgcccgaggccgcgcgcatgagc
agccgcaagcactggctggcctacggcggcaagccggtgggtcgtattctggtcgacgag
ggcgcgcgccgggccctggtcgaaggcgggcgcagcctgctgccggccggcatcatcggc
gtcgagggcagcttcggcctgggcgatctggtcagcctggccacggccgagagcggcgac
tttgcccgcggactggtcggctatcgcagcgacgatgtgagccagctcatgggccgacag
tcctccgacatcgagtccactttggggtataaatacctcgatgccgtcatgcatcgtgac
gatctcgtcctcttgtga

DBGET integrated database retrieval system