KEGG   Haliangium ochraceum: Hoch_0435Help
Entry
Hoch_0435         CDS       T01103                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hoh  Haliangium ochraceum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hoch_0435
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hoch_0435
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Hoch_0435
Enzymes [BR:hoh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Hoch_0435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(596927..598282)
Genome map
AA seq 451 aa AA seqDB search
MGPMYRAWFQCFSGCEGQLPLDSVVYRCPHCNGLLDIVHAREPLRRRSAAAWMQLFDSRV
MSTQWPYGSGVWGKKEWVAPHVESEHVVSMFEGSTNLMWTGRYGESIGVPNLWVKQCGNS
HTGSFKDLGMTVLVSTVKQMIAQGKNIPAIACASTGDTSASLAAYAAAAGIRAVVILPRG
KITTAQLVQPLSSGALVLAIDTDFDGCMRLVTELAEREGVYLANSMNSLRLEGQKTVAIE
MVQQFNWEVPDWVVIPGGNLGNVSALGAGFEMMLELGLIAKRPRICVAQAAHANPLYQSF
QSKFEQFEPMQAKPTLASAIQIGNPVSYQRAVRALERFEGVVEQATEAELADAAARADLA
GMFCCPHTGVALAALEKLVARGEVTRDDRVVVVSTANGLKFTDFKIQYHEDQLADVPQPR
HRNEPIPLADEYEAVRSAVLRDIEARRDASA
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggggcccatgtaccgcgcttggtttcagtgcttctcgggttgcgagggacagctgccg
ctcgactcggtggtctatcgctgtccgcactgcaacggcttgctcgacatcgtccacgcg
cgcgagccgctgcgccggcgctcggcagccgcctggatgcagctcttcgacagccgcgtg
atgtcgacccaatggccctacggctcgggcgtgtggggcaaaaaggagtgggtggccccg
cacgtggagagcgagcacgtggtgtcgatgttcgagggctccaccaacttgatgtggacc
ggacgctacggcgagagcatcggcgtgcccaacctgtgggtcaagcagtgcggcaactcg
cacaccggttcgttcaaggacctgggcatgaccgtgctggtgtccacggtcaaacagatg
atcgcccagggcaaaaacatcccggccatcgcctgcgcctccaccggcgacacctcggcg
tcgctggccgcctacgcggccgccgccggcatccgcgccgtggtcatcctgccgcgcggc
aagatcacgaccgcccagctcgtgcagccgctgtccagcggcgccctggtgctggccatc
gacaccgacttcgacggctgcatgcgcctggtcaccgagctggccgagcgcgagggcgtg
tacctggccaactcgatgaactcgctgcgcctcgagggccagaagaccgtggccatcgag
atggtgcagcagttcaactgggaggtgcccgactgggtggtcatccccggcggcaacctg
ggcaacgtgtcggcgctgggcgcgggcttcgagatgatgctcgagctgggcctgatcgcc
aagcggccgcgcatctgcgtcgcccaggcggcccacgccaacccgctgtatcagagcttt
cagagcaagttcgagcagttcgagccgatgcaggccaagcccacgctggcctcggcgatt
cagatcggcaacccggtcagctatcagcgcgcggtgcgcgcgctcgagcgcttcgagggc
gtggtcgagcaggccaccgaggccgagctcgccgacgcggccgcgcgcgccgatctcgcc
ggcatgttctgctgcccgcacaccggcgtggccctggccgcgctcgagaagctggtcgcc
cgcggcgaggtcacgcgcgacgaccgcgtggtcgtggtgtccacggccaacggcctcaag
ttcacggacttcaagatccagtatcacgaggaccaactcgccgacgtgccccagccgcgc
caccgcaacgagcccatcccgctcgccgacgagtacgaggccgtgcgcagcgcggtgctg
cgcgatatcgaggcccgtcgcgacgcctccgcatga

DBGET integrated database retrieval system