KEGG   Haliangium ochraceum: Hoch_1658Help
Entry
Hoch_1658         CDS       T01103                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
hoh  Haliangium ochraceum
Pathway
hoh00071  Fatty acid degradation
hoh00280  Valine, leucine and isoleucine degradation
hoh00281  Geraniol degradation
hoh00310  Lysine degradation
hoh00362  Benzoate degradation
hoh00380  Tryptophan metabolism
hoh00410  beta-Alanine metabolism
hoh00640  Propanoate metabolism
hoh00650  Butanoate metabolism
hoh00903  Limonene and pinene degradation
hoh00930  Caprolactam degradation
hoh01040  Biosynthesis of unsaturated fatty acids
hoh01100  Metabolic pathways
hoh01110  Biosynthesis of secondary metabolites
hoh01120  Microbial metabolism in diverse environments
hoh01130  Biosynthesis of antibiotics
hoh01200  Carbon metabolism
hoh01212  Fatty acid metabolism
Module
hoh_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Hoch_1658
   00650 Butanoate metabolism
    Hoch_1658
  Lipid metabolism
   00071 Fatty acid degradation
    Hoch_1658
   01040 Biosynthesis of unsaturated fatty acids
    Hoch_1658
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Hoch_1658
   00310 Lysine degradation
    Hoch_1658
   00380 Tryptophan metabolism
    Hoch_1658
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Hoch_1658
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Hoch_1658
   00281 Geraniol degradation
    Hoch_1658
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Hoch_1658
   00930 Caprolactam degradation
    Hoch_1658
Enzymes [BR:hoh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Hoch_1658
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Hoch_1658
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Hoch_1658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DFP NAD_binding_2 NAD_binding_8 Pyr_redox_2 ApbA 2-Hacid_dh_C DAO XdhC_C Pyr_redox_3 F420_oxidored Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ACY14208
UniProt: D0LWW1
Position
2257884..2260064
Genome map
AA seq 726 aa AA seqDB search
MSSDAISVSTDENGIAVLVIDRPDSSANYLSGELAMALLATVERLAADEDLRGVVLSSTK
PGSFVHGSELREFVGAYESGLGAAGAREISRAFQHLTRRMETCGKLFAAALAGPALGSGL
ELALACHHRVLADDPAAVLGLPEVCCGLIPGGGGTQRLPRLIGIERALPLLLSGRPVGPA
EALALGLVHALAPAGRVVDAARAWMSEAREATQPWDRRGFSLPGGNGAESPAVRTAFMVE
TARVRAKTQGKLPAPLALLSSVYEGTITDFDTGLRIESNYFGQMFATPVARNLMRTLFIN
KPAVDALAYRPREVPLSQVRTLGVIGAGAMGAGIACAAASAGIDVELIDQSAELAEEGRV
YAERQLATAVQRGKLGAGAATAILARIAPSADYTRLGRCDLAIEAVYENRDLKRSVIARA
EAELTSTAVLASSTSSLPIGGLARASRRPTQFLGMHFSAPAERMAMVEVITSAHTSQESL
CLALDFAAQLGKTPILVNDGPAFYTTRVFSTFIDEGTCMLSEGVAPALIENAARRAGMPV
GPLAEFDEVSLELSAKIIAQARADGLSAERTRADAAPVIATMMELGRRGRRYGAGFYEYP
EAGKKYLWPGLGEHFPVSAEQPSVDELETRFLTIQALEAVRCVEDGVIASAAEADLGAVL
GFGYPTWTGGTLSYVDMRGHARFIADCERFTERYGPRYEPSAWLRAHAETGQLFHPKTPA
PEALIL
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtgatgcgatttccgtcagcacggacgaaaacggcatcgccgtgctggtcatc
gatcgccccgacagcagcgccaactacctgagcggtgagctggccatggcgctgttggcc
acggtcgagcgcctcgcggccgatgaggatctgcgcggtgtggtgttgagttcgaccaag
cccggcagcttcgtccacggcagcgagctgcgcgagttcgtcggcgcctacgagagcggc
ctgggcgcggccggcgcgcgcgagatcagccgtgcgtttcagcacctcacgcgccgcatg
gagacctgcggcaagctgttcgcggctgcgcttgccggtccggcgctgggcagcggcctc
gagctggcgctggcctgtcaccaccgcgtgctggccgacgatcccgccgccgtgctgggc
ttgcccgaggtctgctgcggcctcatcccgggcggtggcggcacccagcgcttgccgcgc
ctgatcggtatcgagcgcgcgctgccgctgctgctcagcggtcgcccggtggggccggcc
gaggccctggcgctcggtctggtgcacgcgttggccccggccgggcgcgtggtggacgcc
gcgcgcgcgtggatgagcgaggcccgcgaggccacccagccctgggatcgccgcggcttc
tcgctgcccggaggcaacggcgccgagagcccggcggtgcgcacggccttcatggtcgag
accgcgcgcgtgcgcgccaagacccagggcaagctgccggccccgcttgcgctgctgtcg
agcgtctacgagggcacgatcaccgatttcgacaccggcctgcgcatcgagtcgaactat
ttcggacagatgttcgcgaccccggtggcgcgcaacctcatgcgcacgctgttcatcaac
aagcccgcggtcgacgccctggcgtaccggccgcgcgaggtgcccctcagtcaggtgcgc
acactcggcgtcatcggcgcgggtgccatgggcgccggcatcgcgtgcgcggccgcgagc
gccggcatcgatgtcgagctgatcgatcagagcgcagagctcgccgaggagggcagggtc
tacgccgaacgccagctcgccaccgcggtgcagcgcggcaaactcggcgccggcgcggcc
accgccatcctggcgcgcatcgcgccgagcgccgactacacccgactggggcgttgcgat
ctggcgatcgaggcggtgtacgaaaaccgcgatctcaaacgctcggtcatcgcgcgcgcc
gaagccgagctgacgagcacggcggtgctggccagctccacctcgtcgttgcccatcggc
ggtttggcgcgcgcgtcgcggcggccgacgcagtttctcggcatgcacttctccgcgccc
gccgagcgcatggccatggtcgaggtgatcacgagcgcgcacacctcgcaggagagcctg
tgcctggccctggattttgccgcgcagctcggcaagacgccgattctggtcaacgacggg
ccggcgttctacaccacgcgggtattctcgaccttcatcgacgagggcacgtgcatgctc
agcgagggcgtggcgcccgcgctcatcgagaacgcggcccggcgcgcgggcatgcccgtc
ggaccgttggccgaattcgacgaggtgagcctcgagctgtcggccaagatcatcgcccag
gcgcgtgccgacgggctgtcggccgagcgcacgcgcgcggacgctgcgcccgtgatcgcc
accatgatggagcttggccgccgcggtcgccgctacggcgccgggttctacgaatatccc
gaggccggcaagaaatatctgtggcccgggctgggcgagcactttccggtttccgccgag
cagcccagtgtcgacgaactcgagactcgctttttgaccattcaggcgcttgaagccgtc
cgctgcgtcgaagacggcgtcatcgccagcgcggccgaggccgatctgggcgcggtgctc
ggctttggctacccgacctggaccggcggcaccctgagctatgtcgacatgcgcggacac
gcgcgctttatcgccgattgcgagcgcttcaccgagcgctacggcccgcgctacgagccc
tcggcgtggctgcgcgcgcacgccgagacgggtcagctctttcaccccaaaaccccggcg
cccgaggcgctgattctctga

DBGET integrated database retrieval system