KEGG   Haliangium ochraceum: Hoch_1660Help
Entry
Hoch_1660         CDS       T01103                                 

Definition
NAD-binding 3-hydroxyacyl-CoA dehydrogenase protein
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
hoh  Haliangium ochraceum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hoch_1660
   01212 Fatty acid metabolism
    Hoch_1660
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Hoch_1660
   00650 Butanoate metabolism
    Hoch_1660
  Lipid metabolism
   00071 Fatty acid degradation
    Hoch_1660
   01040 Biosynthesis of unsaturated fatty acids
    Hoch_1660
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Hoch_1660
   00310 Lysine degradation
    Hoch_1660
   00380 Tryptophan metabolism
    Hoch_1660
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Hoch_1660
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Hoch_1660
   00281 Geraniol degradation
    Hoch_1660
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Hoch_1660
Enzymes [BR:hoh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Hoch_1660
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Hoch_1660
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Hoch_1660
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     Hoch_1660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2261389..2263557
Genome map
AA seq 722 aa AA seqDB search
MFQGQSLRVTRISDHFAEICFDREGEAINKLDKRTVDELGTAVSSIADDGDVRGVLITSA
KKVFIVGADITEFGALFALPVERLVATNSASNSTLTALESLPVPCVVALGGVALGGGLEL
ALAADFRVMSTAAQVGLPEVQLGLFPGFGGTVRLPRIAGAAVAIEWITSGASAGAEAALA
AGVVDEVCAPEKLRERALTLLRTAVAGERDWHARRRAKDAPLPLKDDERAALFGAAREQV
ARRAPKHQPAAMSALEAMARAATAERTRALEIEARAFAEVAKTQAADALVQTFLSGQQVK
KITRGYRELAAPVARAAVLGAGIMGGGIAYTSALRGVRVILKDIAQAQLERGMDEARGLL
GKRVKRGKMNQEQADAVLGAITPQLDYTDFDQVDVVVEAVSESLALKHQVLAEVEAQVRE
GAILASNTSSLRIDELAPALARPENLVGMHFFNPVPAMPLVEIIRGSRTSPAALATVVGY
AEAMGKTPIVVADGPGFLVNRVLTPYMQAFAKLVADGADFVQVDAAMEAFGWPMGPAYLN
DVVGMDTAVHVAEIIIAGFPERMARMAPDPLALMVERGRLGQKSGLGFYRYQAGAGGRPE
KSVAEDSRALLAALQEEGSSTVTDGEIVERMMLPMIFEAAQCLEEGVVGSAPELDLAMLL
GVGFPAYLGGPLKYADWLGARELLARAQRYAHLGPQYTPPRSVRDMAEGGKRFYPRPSAT
AS
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaggacaatcgctgcgcgtcacgcgcatttccgaccactttgccgaaatctgc
ttcgaccgcgagggcgaggccatcaacaagctcgacaagcgcacggtcgacgagctcggc
accgccgtgtccagcatcgcggacgacggcgatgtgcgcggcgtgctgatcaccagcgcc
aagaaggtgttcatcgtcggcgccgacatcaccgagttcggcgccctgttcgcgttgccg
gtagagcgactggtggccaccaacagcgcctccaacagcaccttgaccgcgctcgagagc
ctgcccgtgccctgtgtggtcgcgctcggcggtgtcgcgctcggcggcggtctggagctg
gcgctggccgccgacttccgggtgatgtccacggccgcacaggtaggtctgcccgaggtc
cagctcggtctgttcccgggctttggcggcactgtgcgcctgccgcgtatcgccggcgcc
gcggtcgccatcgagtggatcaccagcggcgcgtcggcgggcgccgaggccgcgctcgcg
gccggcgtggtcgacgaggtgtgcgcgcccgagaagctgcgcgagcgcgccttgaccctg
ctgcgcaccgcggtcgccggcgagcgcgactggcacgcgcggcgtcgggcaaaggatgcg
ccgctgccgctgaaggacgacgagcgcgcggcgctgttcggcgcggctcgcgagcaggtc
gcgcggcgcgctcccaagcatcaacccgcggccatgagcgcgctcgaggcgatggcgcgg
gcggcgacggccgagcgcacgcgcgcgctcgagatcgaggcccgcgcctttgccgaggtc
gccaagacccaggccgcggatgcgctggtgcagacatttctcagcggacagcaggtcaaa
aaaatcacccgcggctaccgcgagctggccgccccggtcgcgcgcgcggccgtgctcggc
gccggcatcatgggcggcggcatcgcctacaccagcgcgctgcgcggtgttcgcgtgatc
ctcaaggacatcgcccaggcccagctcgagcgcggaatggacgaggcccgcgggctgctg
ggcaagcgggtcaagcgcggcaagatgaaccaggagcaggccgacgcggtgctgggcgcc
atcacgccgcagctcgattacacggatttcgaccaggtggacgtcgtcgtcgaggcggtg
agcgagtcgctcgcgctcaaacaccaggtgctcgccgaggtcgaggcccaggtgcgcgag
ggcgcgatcctggcgagcaacacctcgagcctgcgcatcgacgaactggcgcccgcgctg
gcgcgtcccgagaacctggtcggcatgcacttcttcaaccccgtgcccgcgatgccgctg
gtcgagatcatccgcggctcgcgcaccagccccgcggcgctcgccaccgtggttggctac
gccgaggccatgggcaagaccccgatcgtggtcgccgatggccccgggtttctggtcaat
cgcgtgctcacgccgtacatgcaggcctttgccaagctggtcgccgatggcgccgacttc
gtccaggtggacgccgccatggaggcctttggttggcccatgggcccggcgtatctcaac
gacgtggtcggcatggacaccgccgtccacgtcgccgaaatcatcatcgccggcttcccc
gagcgcatggcgcggatggcgccggatccgctggcgctcatggtcgagcgcggccgcctg
ggccagaagagcggcctcggcttctaccgctaccaggccggtgctggcggcagacccgaa
aaatccgtggccgaggacagtcgggcgctgctcgcggcgctgcaggaggagggatcctcc
actgtgacggacggcgagatcgtcgagcgcatgatgctgccgatgatcttcgaggcggcg
cagtgcctcgaggagggcgtggtcggcagcgcgcccgagctggacctggccatgctcttg
ggcgtcggcttcccggcttacctcggcggtccgctcaagtacgccgactggttgggcgcg
cgcgagctgctcgcccgggcccagcgctatgcgcatctgggcccgcagtacacgccgccg
cgcagcgttcgcgacatggccgaaggcgggaaacgcttctacccgaggccgagcgcgacc
gcctcttga

DBGET integrated database retrieval system