KEGG   Haliangium ochraceum: Hoch_1954Help
Entry
Hoch_1954         CDS       T01103                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K15792  
murE/murF fusion protein [EC:6.3.2.13 6.3.2.10]
Organism
hoh  Haliangium ochraceum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Hoch_1954
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Hoch_1954
Enzymes [BR:hoh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     Hoch_1954
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Hoch_1954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2693042..2696149
Genome map
AA seq 1035 aa AA seqDB search
MKLATLIQDLAELAAVRVVGDDARDIRAVRDDSRRVGPGDLFVAVRGARTDGHAYLPAVI
DAGAAAVVVERAIEDPALAARVTQVIVPEGARALGVLAARMAGRPGERMRLVGITGTNGK
TTCSYLIESILRAHDATCGVIGTVSYRYGAREVPAPYTTPTALILQEALGEMVAASCTHA
VLEVSSAALAMERLSGTTVEVAAFTNFTQDHLDVHGSMDAYRAAKERLFRDHLAENGVAV
IDVDDKAAPHMIAAAGERRVVRVSARPGATAADAEVRVLAAETTIAGITAEFATPRGSFT
LRAPALLGHYNVANLAVAVAVCDALDVPHATIARGIEAMSGVPGRVERVANDAGLDILVD
YAHTPDALASVLAALRPLTQRRLLCVFGCGGDRDADKRPKMGAAAAAGADLVVVTSDNPR
SEAPRAIIDQILPGVPAPFFVHSDRRVGIAAAVFEAVPGDIVLIAGKGHETYQILGDDTV
HFDDREEAARAAAARWGFPLAEMAAAAGGVLHAPEGCAEAASRVVIDGRQVAPGDLYVAI
RGEQHDGHAFCEQAANAGACALMVERGRAPRDAAGNALKLAVIEVDDTRLALGSVARWHR
ARWGELPVYGCPNTGGDRDGDNGDERARAAKPVVGITGSAGKTTTKELIAAALSARYAVH
ATRASFNNETGVPLTLLALMPHHGAAVIEMGMRGLGQIAYLAELSAPTVAAVLNAGTAHI
GVVGSAEGIVRGKSEIFAALGEGGVAVYPGDDERLSEYARAAGRVLRFTQALPSGDEVPT
PAPAEVCAVAYAPAHRAGPGAATDAATDAATGAATGAATKVLVGADIDLRVQLSPADDAR
VVRVPLALVGRHNAANAACALACAIAAGVSAEDAAAAMGRARPPALRGQVRELAGRRVLV
DCYNANPASMRAALATLTELARADGSRALAVLGDMLELGDEAARAHAEVGQMAGDLDVAV
IALGEHAAALAGAGAPGDDLARVAASPDEAAAFLLSHTAPGDWVLVKGSRGMRLERVIDA
ALVLVSAQERPSGET
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atgaagctggccaccttgatccaagatctcgcggagctcgccgcggtccgcgtcgtcggc
gatgacgcgcgcgatatccgcgccgtccgcgacgactcgcgccgcgtcggcccgggtgat
ctcttcgtcgccgtgcgcggcgcacgcaccgatggccacgcgtatctgcccgccgtcatc
gacgccggcgccgcggccgtggtggtcgagcgcgccatcgaggatcccgccctggccgcg
cgcgtcacccaggtgatcgtgcccgagggcgcgcgtgcgctcggtgtcctggccgcgcgc
atggccggccgcccgggcgagcgcatgcgcctggtcggcatcacgggcaccaacggcaag
accacgtgcagctacctcatcgagtcgatcctgcgcgcccacgacgccacctgcggcgtc
atcggcaccgtgagctaccgctacggcgcgcgcgaggtgccggcgccgtacaccacgccg
accgcgctcatcctgcaagaggcgctgggcgagatggtcgcggcctcgtgcacgcacgcg
gtgctcgaggtgtcctcggcggcgctggccatggagcgcttgtccggcaccaccgtcgag
gtcgccgcgttcaccaacttcacccaggatcacctcgacgtccacggctccatggacgcc
taccgcgcggccaaggagcgcctgtttcgcgaccacctggccgaaaacggcgtcgccgtc
attgatgtcgatgacaaggctgcgccgcacatgatcgcggccgccggcgagcgtcgggtg
gtgcgggtgtcggcgcggcccggggccacggccgcggacgccgaggtgcgcgtgctcgcg
gccgagaccacgatcgccggcatcacggccgagttcgccaccccgcgcggcagcttcacg
ctgcgtgcgccggccctgctcggccactacaacgtcgccaacctggccgtggccgtggcc
gtgtgcgacgctctcgatgttccccacgccaccatcgcccgcggcatcgaggccatgagc
ggcgtgcccggccgggtcgagcgcgtggccaacgacgccgggctcgacatcctggtcgac
tacgcgcacacgcccgacgcgctcgccagcgtgctcgccgcgctgcgcccgctcacccag
cgccgcctgctgtgcgtgttcggctgcggcggcgaccgggatgcggacaagcgtccgaag
atgggcgcggccgcggctgccggtgccgacctggtggtcgtgacctcggacaatccccgc
tcggaggcgccgcgcgccatcatcgatcagatcttgcccggggtgccggcgccgtttttc
gtccacagcgaccgccgcgtgggcatcgcggccgccgtgttcgaggccgtgcccggcgac
atcgtgctcatcgccggcaagggccacgagacctatcagatcctcggcgacgacaccgtg
cacttcgacgaccgcgaggaggcagcgcgggccgcggccgcgcgctggggctttcctctg
gccgagatggcggccgcagccggcggcgtattgcacgcgcccgagggctgcgccgaggcg
gcctcgcgggtggtgatcgacggccgccaggtggcgcccggcgacctgtacgtggccatc
cgcggcgagcagcacgatggccacgcgttctgcgagcaggccgcgaacgccggcgcgtgc
gcgctcatggtcgagcgcggtcgggcgccgcgcgacgccgcgggcaatgcgctgaagctg
gccgtgatcgaggtcgatgacacgcgcctggccctcggctcggtggcccgctggcaccgc
gcccgctggggcgagctgccggtgtacggctgtccgaatacgggtggcgatcgcgacggc
gacaacggcgacgagagagcgcgcgcggccaagcccgtggttggcatcaccggctcggcc
ggcaagaccaccaccaaggagctcatcgccgcggctctgagcgcgcgctacgcggtgcac
gccacgcgcgcctcgttcaacaacgagaccggcgtgccgctcaccctgctggccctgatg
ccgcaccacggcgccgccgtcatcgagatgggcatgcgcggcctgggccagatcgcgtat
ctggccgagctgagcgcgcccaccgtggccgcggtgctcaacgccggcaccgcccacatc
ggcgtggtcggcagcgccgagggcatcgtccgcggcaagtccgagatcttcgccgcgctg
ggcgagggcggcgtggccgtgtacccgggcgatgacgaacgactgtccgaatacgcccgt
gcggccgggcgcgtgctgcgcttcacccaggccctgcccagcggcgacgaggtgcccacg
ccggcgccggccgaggtctgcgccgtggcctacgcgcccgctcatcgcgccggccccggc
gcggcgacagacgcggcgacagacgcggcgaccggcgcggcgaccggtgcggcgacgaag
gtcttggtcggcgccgacatcgacctgcgggtgcagctctcgcccgccgatgatgcccgc
gtggtgcgcgtgccgctggccctggtgggccggcacaacgcggccaacgcggcctgtgcg
ctggcctgcgcgatcgcggccggcgtgtcggccgaggacgcggccgcggccatggggcga
gcccggccgccggcgctgcgcggccaggtccgcgagctggccggccgtcgcgtgctggtc
gattgctacaacgccaaccccgcctcgatgcgcgcggcgttggccacgctcaccgagctg
gcgcgcgccgacggcagccgcgcgctggccgtgctcggcgacatgctcgagctcggcgac
gaggccgcccgcgcccacgccgaagtcggacagatggccggcgacctcgatgtcgccgtc
atcgccctcggcgaacacgccgccgccctggccggcgccggtgcccctggcgacgatctc
gcgcgcgtggccgccagccccgacgaggccgccgctttccttctgagccacaccgcgccc
ggcgattgggtgctggtgaaaggctcgcgcggcatgcgcctcgagcgcgtgatcgacgcc
gcgctcgtgctcgtgtctgctcaagaacgccccagcggagagacctga

DBGET integrated database retrieval system