KEGG   Haliangium ochraceum: Hoch_1987Help
Entry
Hoch_1987         CDS       T01103                                 

Definition
alpha-galactosidase-like protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
hoh  Haliangium ochraceum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Hoch_1987
  Lipid metabolism
   00561 Glycerolipid metabolism
    Hoch_1987
   00600 Sphingolipid metabolism
    Hoch_1987
Enzymes [BR:hoh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Hoch_1987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2741597..2743945)
Genome map
AA seq 782 aa AA seqDB search
MSVAVDWDAGQRVFVLTGAFAQPVRFSSSFCVTQQGQRQRGRTIDAAMGTPSRTRGRGRD
AWTFEQRGVRLTLAWEAPAKNALLLHSRLENTGRAPVLLQQITPARFDHSLPHFDDLEAT
RVYREGFQSWSPAGSVAATSVQEYPLLPLIAPMHHHIDAPDWGRDDGLLSFLFTLLQTGD
ERATLLGFLGQRVGLGTLFLQNRGTSTLTATLDYGGKRLWPGQSVTGEPLALYRGQPGTI
VERYVKAVAASMDARPPARSPSGWCSFYELRGKVAAEDIRENARVLAAHPEFAAEFVQLD
DGYQSAVGDWLRPNRKFPGGLAQVARDIRARGFRPGIWLAPFFAAKRSRLLREHPGWFLR
DPRDRPLHVATHVAWKTPLYGLDLSHPAVEAWLGDLFGRLAACGFDYFKADFLFAGVRTG
TRFDPALSPVECYRRGLAAIQAAIGPERYLLASGAPIGPSIGLVDGMRVSADNKEVWHEP
LVAALARGAGAPSAHDCLRNTLTRSFMHGAWWRNDPDCLLVRDHDTDLTLDEVRLLVTVQ
GMSGGALFLSDDLANVDLGRLHLAAAVLPPTPMQAALADPMARDFPENFELRGPHSRVLA
LVNATSNRRITDTDIHDEHVFDFWAEQMVLTPPCIAPAHGVSALQITPRGEVPALVGTDL
HLTALADGRIRSRYDAAERVLIINAEPLARRHGALWLALPEGYEAHPSDPRIKRVSTWEQ
GLVLEVKTHEGPSGLELAGSEPRQAANQTGARAQRAGWTLRIPCTAPSERPADPGSRSGT
VL
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtggccgtcgattgggacgcgggccagcgcgtcttcgtgctcacgggcgcgttt
gcgcagccggtgcgcttctcgagctccttctgcgtcacccagcagggccagcgccagcgc
ggccgcaccatcgacgcggccatgggcacgccctcgcgcacccgcggccgcggccgcgac
gcctggaccttcgagcagcgcggcgtgcgcctcaccctggcctgggaggcgccggccaag
aacgccctgctgctgcactcgcggctcgagaacaccggccgcgcgcccgtgctgctgcag
cagatcacgcccgcgcgcttcgatcacagcctgccgcacttcgacgatctcgaggccacg
cgcgtctaccgcgagggcttccagagctggtcgccggcgggctcggtcgcggccaccagc
gtgcaggagtacccgctgctgccgctgatcgcgcccatgcaccatcatatagacgccccc
gactgggggcgcgatgacggcctgctgtcgtttctgttcacgctgctgcagaccggcgac
gagcgcgccacgctgctgggctttctcggacagcgggtcggactcggcaccctgttcctg
caaaatcgcggcaccagcacgctcacggctacgctcgactacggcggcaagcgcctgtgg
ccggggcagagcgtcaccggcgagcccctggccctgtaccgcgggcagccgggcaccatc
gtcgagcgctacgtcaaggcggtggccgcatccatggacgcgcgtccgcccgcgcgcagc
cccagcggctggtgctcgttctacgagctgcgcggcaaagtcgcggccgaggacatccgc
gagaacgcgcgcgtactcgccgctcaccccgaattcgcggccgaattcgtacaactggac
gacggctaccagagcgcggtcggcgactggctgcgccccaaccgcaagttcccgggcggc
ctggcccaggtggcgcgcgacatccgcgcccgcggctttcgccccggcatctggctggcg
cccttcttcgcggccaagcgctcgcggctgctgcgcgagcatccgggctggtttctgcgc
gacccgcgcgaccggccgctgcacgtggccacccacgtggcctggaagacgccgctctac
ggcctcgatctcagccatcccgcggtcgaggcctggctcggcgatctcttcggccggctc
gcggcctgcggcttcgactacttcaaggccgacttcctgttcgccggcgtacgcacgggc
acccgcttcgacccggcgctgtcgccggtggagtgctaccgccgcggcctggccgcgatc
caggcggccatcggccccgagcgctacctgctcgccagcggcgcgcccatcggcccgtcc
atcggtctggtcgacggcatgcgcgtctcggccgacaacaaagaggtatggcacgagccg
ctggtggcggcgctggcgcgcggcgctggcgcgccctcggcccacgactgcctgcgcaac
acgctcacccgctcgttcatgcacggcgcctggtggcgcaacgatcccgactgcctgctg
gtgcgcgaccacgacaccgatctcaccctcgatgaggtccggctgctggtcacggtccag
ggcatgagcggcggcgcgctgttcctcagcgacgacctcgccaacgtcgatctcggccgc
ctgcacctggccgccgcggtgctgccgccgacgccgatgcaggccgcgctggcggatccc
atggcccgcgacttccccgagaacttcgagctgcgcgggccgcacagccgggtgctggcg
ctggtcaacgcgacctcgaaccggcgcatcaccgacaccgatatccacgacgagcacgtg
tttgatttctgggccgagcagatggtgctcacgccgccgtgcatcgcgcccgcgcacggc
gtgtccgcgctgcagatcacgccgcgcggcgaggtccccgccctggtcggcaccgatctc
cacctcaccgcgctggccgatggccgcatccgctcgcgctacgacgcggccgagcgcgtc
ctgatcatcaacgccgagcccctggcgcggcgtcacggggcgctgtggctggcgctgccc
gagggctacgaggcccaccccagcgatccccgcatcaagcgcgtgagcacctgggagcag
ggcctggtgctcgaggtgaagacccacgagggcccctccgggctcgagctcgcgggctcg
gagccgcggcaagcggccaaccagaccggcgcgcgcgcccagcgcgcgggctggaccctg
cggattccgtgcactgcgccgagcgaaaggcccgctgacccagggtcgagatccgggact
gttttgtga

DBGET integrated database retrieval system