KEGG   Haliangium ochraceum: Hoch_2078Help
Entry
Hoch_2078         CDS       T01103                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
hoh  Haliangium ochraceum
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Hoch_2078
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Hoch_2078
Enzymes [BR:hoh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Hoch_2078
Two-component system [BR:hoh02022]
 CheA family
  CheA-CheYBV
   Hoch_2078
Bacterial motility proteins [BR:hoh02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Hoch_2078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2876241..2876876
Genome map
AA seq 211 aa AA seqDB search
MLPPASRRRPYPGHATEIVIDIGVVVAGASLGGLEAFRQVLGELGEEFAVPVVIAQHRAA
EEGDRLVRILDSFCALRVVEPEDKEPLTPGTVYLAPADYHLLIDGERCALSLEERVLFAR
PSIDVLFESAADSFGARALSVLMTGSSSDGAAGTLAIKRAGGIAVVEDPACAFSPVASMA
ALALTSVDYVVPLASIAGTVKMLCRKEDDAK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgttgccgcccgctagccgccgcagaccgtatcccggacacgcgaccgaaatcgtcatc
gatatcggcgtggtggtggcgggggcgtcgctgggcgggttggaggcgttccgccaggtg
ctgggcgagctgggcgaggagttcgcggtgcccgtggtcatcgcccagcatcgcgcggcc
gaggagggtgaccgtctggtgcgcatcctcgattcgttttgcgcgctgcgggtggtcgag
cccgaggacaaggagccgctcacgccgggcacggtgtatctggcgccggccgattatcat
ctgctgatcgacggcgagcgctgcgcgctgtcgctcgaggagcgcgtgcttttcgcgcgt
ccgtcgatcgacgtgttgttcgagtcggcggccgacagttttggcgcgcgcgcgctgtcg
gtgctgatgaccggttcgagttcggacggggcggcgggaaccctggcgatcaagcgcgcc
ggcggcatcgccgtggtcgaagatccggcgtgtgcgttcagcccggtggcgtcgatggcg
gcgctggcgctgacctcggtggattatgtggtgccgctcgccagtatcgcggggacggtg
aagatgctgtgtcgcaaagaggatgacgctaaatga

DBGET integrated database retrieval system