KEGG   Haliangium ochraceum: Hoch_2276Help
Entry
Hoch_2276         CDS       T01103                                 

Definition
Diphosphate--fructose-6-phosphate1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hoh  Haliangium ochraceum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hoch_2276
   01230 Biosynthesis of amino acids
    Hoch_2276
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hoch_2276
   00030 Pentose phosphate pathway
    Hoch_2276
   00051 Fructose and mannose metabolism
    Hoch_2276
   00052 Galactose metabolism
    Hoch_2276
  Energy metabolism
   00680 Methane metabolism
    Hoch_2276
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Hoch_2276
Enzymes [BR:hoh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Hoch_2276
Protein phosphatases and associated proteins [BR:hoh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Hoch_2276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3166300..3167637)
Genome map
AA seq 445 aa AA seqDB search
MNTTPKRGDHIRRVGIIFAGGPAPAANAVISSAAISFIEDGREVVGFFHGYSNLQDYHPV
SNRLLPDEHYRVFQERDLRGLRNSRGIIIGTARANPGKPIKGPADLDDPEKTSKLRNVYN
ALVDLEIDALISIGGDDTLKTANFLHEFQKRLPENARRVKVVHLPKTIDNDYRGIDFTFG
FFTAVDVMAKEVQNLRADAMATHSYFVIETMGRKAGWLSYGVAIAGESNLVLATEDIVGD
LAYEEEFTDAATGEKGRRQRVKLDALVDRVVDLILTRERRGKHYGTVVIAEGVGELLPES
ALAAMPRDEHGHLSLGRVDIGKLIAQKVSERYEQRVGQKKKVTGVQLGYESRCAQPHAFD
VMLGSQLGIGAYRALVEENLDGHMVSATGQLDLRYVRFDELVNPETLKTEVRFIERGSDF
HQLARFLETRVDRIDDWSPGRRPES
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaacgcccaaacgcggcgaccacatccggcgggtcggcatcatcttcgccggc
ggccccgcgcccgcggccaacgcggtgatctcctcggcggctatctcgtttatcgaggac
ggacgcgaggtggtcggcttctttcacggctactcgaacctccaggactaccacccggtc
agcaaccggctgctgcccgacgagcactaccgggtgtttcaggagcgcgacctgcgcggc
ctgcgcaactcgcgcggcatcatcatcggcaccgcgcgcgccaacccgggcaagcccatc
aaaggcccggccgatctcgacgacccggagaaaacctccaagctgcgcaacgtgtacaac
gccctggtcgacctcgagatcgacgcgctgatctcgatcggtggcgacgacacgctcaag
accgccaacttcctgcacgagttccagaagcggcttcccgagaacgcgcgccgggtcaag
gtcgtgcacctgcccaagaccatcgacaacgactaccgcggcatcgacttcaccttcggt
ttcttcaccgcggtcgacgtcatggccaaggaggtgcaaaacctgcgcgccgacgccatg
gccacgcactcgtacttcgtcatcgagaccatgggccgcaaggccggctggctgtcgtac
ggcgtggccatcgccggcgagtccaacctggtgctggccaccgaggacatcgtcggcgat
ctggcgtacgaggaggagttcaccgacgcggccacgggcgagaaggggcgccgccagcgc
gtcaagctcgatgccttggtcgaccgcgtggtcgatctcatcctcacccgcgagcgccgc
ggcaagcactacggcaccgtggtcatcgccgagggcgtgggcgagctgttgcccgagagc
gcgctcgccgccatgccgcgcgacgagcacggccacctctcgctcggccgcgtcgacatc
ggcaagctgatcgcgcagaaggtctccgagcgctacgagcagcgcgtcggccagaagaag
aaggtcaccggcgtgcagctcggctacgagtcgcgctgcgcccagccgcacgccttcgac
gtcatgctcggcagccagctcggcatcggcgcctaccgcgccctggtcgaggagaacctc
gacggccacatggtgagcgccaccgggcagctcgacctgcgctacgtgcgcttcgacgag
ctggtcaaccccgagacgctcaagaccgaggtgcgcttcatcgagcgcggcagcgacttc
caccagctcgcgcgcttcctcgagacccgcgtcgatcgcatcgacgactggagcccgggg
cgccgccccgagtcgtaa

DBGET integrated database retrieval system