KEGG   Haliangium ochraceum: Hoch_2276Help
Entry
Hoch_2276         CDS       T01103                                 

Definition
(GenBank) Diphosphate--fructose-6-phosphate1-phosphotransf erase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
hoh  Haliangium ochraceum
Pathway
hoh00010  Glycolysis / Gluconeogenesis
hoh00030  Pentose phosphate pathway
hoh00051  Fructose and mannose metabolism
hoh00052  Galactose metabolism
hoh00680  Methane metabolism
hoh01100  Metabolic pathways
hoh01110  Biosynthesis of secondary metabolites
hoh01120  Microbial metabolism in diverse environments
hoh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hoch_2276
   00030 Pentose phosphate pathway
    Hoch_2276
   00051 Fructose and mannose metabolism
    Hoch_2276
   00052 Galactose metabolism
    Hoch_2276
  Energy metabolism
   00680 Methane metabolism
    Hoch_2276
Enzymes [BR:hoh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Hoch_2276
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Hoch_2276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ACY14819
UniProt: D0LHZ0
Position
complement(3166300..3167637)
Genome map
AA seq 445 aa AA seqDB search
MNTTPKRGDHIRRVGIIFAGGPAPAANAVISSAAISFIEDGREVVGFFHGYSNLQDYHPV
SNRLLPDEHYRVFQERDLRGLRNSRGIIIGTARANPGKPIKGPADLDDPEKTSKLRNVYN
ALVDLEIDALISIGGDDTLKTANFLHEFQKRLPENARRVKVVHLPKTIDNDYRGIDFTFG
FFTAVDVMAKEVQNLRADAMATHSYFVIETMGRKAGWLSYGVAIAGESNLVLATEDIVGD
LAYEEEFTDAATGEKGRRQRVKLDALVDRVVDLILTRERRGKHYGTVVIAEGVGELLPES
ALAAMPRDEHGHLSLGRVDIGKLIAQKVSERYEQRVGQKKKVTGVQLGYESRCAQPHAFD
VMLGSQLGIGAYRALVEENLDGHMVSATGQLDLRYVRFDELVNPETLKTEVRFIERGSDF
HQLARFLETRVDRIDDWSPGRRPES
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaacgcccaaacgcggcgaccacatccggcgggtcggcatcatcttcgccggc
ggccccgcgcccgcggccaacgcggtgatctcctcggcggctatctcgtttatcgaggac
ggacgcgaggtggtcggcttctttcacggctactcgaacctccaggactaccacccggtc
agcaaccggctgctgcccgacgagcactaccgggtgtttcaggagcgcgacctgcgcggc
ctgcgcaactcgcgcggcatcatcatcggcaccgcgcgcgccaacccgggcaagcccatc
aaaggcccggccgatctcgacgacccggagaaaacctccaagctgcgcaacgtgtacaac
gccctggtcgacctcgagatcgacgcgctgatctcgatcggtggcgacgacacgctcaag
accgccaacttcctgcacgagttccagaagcggcttcccgagaacgcgcgccgggtcaag
gtcgtgcacctgcccaagaccatcgacaacgactaccgcggcatcgacttcaccttcggt
ttcttcaccgcggtcgacgtcatggccaaggaggtgcaaaacctgcgcgccgacgccatg
gccacgcactcgtacttcgtcatcgagaccatgggccgcaaggccggctggctgtcgtac
ggcgtggccatcgccggcgagtccaacctggtgctggccaccgaggacatcgtcggcgat
ctggcgtacgaggaggagttcaccgacgcggccacgggcgagaaggggcgccgccagcgc
gtcaagctcgatgccttggtcgaccgcgtggtcgatctcatcctcacccgcgagcgccgc
ggcaagcactacggcaccgtggtcatcgccgagggcgtgggcgagctgttgcccgagagc
gcgctcgccgccatgccgcgcgacgagcacggccacctctcgctcggccgcgtcgacatc
ggcaagctgatcgcgcagaaggtctccgagcgctacgagcagcgcgtcggccagaagaag
aaggtcaccggcgtgcagctcggctacgagtcgcgctgcgcccagccgcacgccttcgac
gtcatgctcggcagccagctcggcatcggcgcctaccgcgccctggtcgaggagaacctc
gacggccacatggtgagcgccaccgggcagctcgacctgcgctacgtgcgcttcgacgag
ctggtcaaccccgagacgctcaagaccgaggtgcgcttcatcgagcgcggcagcgacttc
caccagctcgcgcgcttcctcgagacccgcgtcgatcgcatcgacgactggagcccgggg
cgccgccccgagtcgtaa

DBGET integrated database retrieval system