KEGG   Haliangium ochraceum: Hoch_2310Help
Entry
Hoch_2310         CDS       T01103                                 

Definition
FAD-dependent pyridine nucleotide-disulfide oxidoreductase
Orthology
K00302  
sarcosine oxidase, subunit alpha [EC:1.5.3.1]
Organism
hoh  Haliangium ochraceum
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:hoh00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3211639..3212997)
Genome map
AA seq 452 aa AA seqDB search
MNARLPILDTAPAWARRETPVQLRLDGDPVRGYANESVAVGLYASGHRVLSRSIKYHRPR
AFFCLEGHCGGCLMRIDGVPNQRACQQPCREGLRLEPQNAYPSADLDVLEAVDWLFPGGM
NHHTLMTGSPLLNAVANKIVRKLSGLGEAPTAPPARLPRAEELAPEVLVVGGGPAGLTAA
TAAARGGARTLLIEEQPVLGGSLLADPRFGPVAAHERVEAARAAGVELRASTAALAYYAE
DPQPVLVAASPDSALRLRPQQTVWATGAYAVNAPFVNNDRPGVFAARAVGRLLVQYRVKP
GHRVCIADTGADAYAALLGRALEDAGCEVVRVGGADADSERGERLVRVLGARGHAWVEGA
EVEDARGRSRRIECDIIAVAATPAPASEGPRQHGCQVAYASAAGGFAVQADEFGRAGPSG
VWACGDVCGYQGPERAAERGAEVGAAAAEAVP
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcgcgtctgcccattctcgataccgcacccgcatgggcgcgaagagaaactccg
gttcagctccgactcgacggtgacccggtccgcggctacgccaatgagagcgtcgccgtc
ggcctctacgccagcggccaccgcgtgctctcgcgctccatcaagtaccaccggccgcgc
gccttcttctgcctcgagggccactgcggcggctgcctgatgcgcatcgacggcgtgccc
aaccagcgcgcgtgtcagcagccgtgccgcgagggcctgcgcctggagccgcagaacgcc
tacccctccgccgacctcgacgtgctcgaggccgtggactggctgttcccgggcggcatg
aaccatcacaccctgatgaccggctcgccgctgctcaacgccgtggccaacaagatcgtc
cgcaagctcagcggcctcggcgaggcgcccacggccccgcctgcgcgcctgccccgggcc
gaggagctggcgcccgaggtgctcgtggtcggcggcggccccgcgggactgaccgcggcc
acggcggccgcacgcggcggcgcgcgcaccctgctgatcgaggagcagccggtgctcggc
ggcagcctgctcgccgacccgcgcttcggcccggtcgcggcccatgagcgggtcgaagcc
gcgcgcgccgccggggtcgagctgcgggcgagcaccgcggccctggcctactacgccgaa
gatccccagccggtgctggtcgcggcctcgcccgatagcgccctgcgcctgcgcccgcag
cagaccgtgtgggccaccggcgcctacgcggtcaacgcgcccttcgtcaacaacgaccgc
ccgggcgtattcgccgcgcgcgcggtcggccgcctgctggtgcagtaccgggtcaagccc
ggccatcgagtgtgcatcgccgataccggcgccgacgcctacgccgccctgctcggccgc
gcgctcgaggacgccggctgcgaggtcgtgcgcgtcggcggcgccgatgccgacagcgag
cgcggcgagcgcctggtgcgcgtgctcggcgcgcgcggccacgcctgggtcgagggcgcc
gaggtcgaggacgcgcgcggccgcagccggcgcatcgagtgcgacatcatcgcggtcgcg
gccacgcccgcgccggcctccgagggcccgcgccagcacggctgccaggtcgcctacgcc
agcgcggccggcggctttgccgtccaggcggacgaattcggacgcgccggccccagcggc
gtgtgggcgtgcggcgacgtgtgcggctaccagggccccgagcgcgcagccgagcgcggc
gccgaggtcggcgcagcggccgcggaggcggtgccgtga

DBGET integrated database retrieval system