KEGG   Haliangium ochraceum: Hoch_2584Help
Entry
Hoch_2584         CDS       T01103                                 

Definition
FAD-binding domain-containing protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
hoh  Haliangium ochraceum
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    Hoch_2584
  Amino acid metabolism
   00380 Tryptophan metabolism
    Hoch_2584
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Hoch_2584
Enzymes [BR:hoh01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Hoch_2584
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     Hoch_2584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3568900..3570465)
Genome map
AA seq 521 aa AA seqDB search
MIITASYEGQPPDNARRFVAALDELAPDSLSGLRYAVFGCGNRQWVRTYQAVPKRVDQAL
AAAGATPISERGEGDADGDFFGAFETWSDVLWAALSRGNGDARAPRLRVEVLPAARASVL
QQSTTELGQIVENRELVVMGAPGARSKRHIEIALPAGTRYQPGDYLAILPRNPPERIERV
LRRFGLAEDTQIVVRPGGDNASPAGAGLALPSGYPIAAGELLAGYLELGQPATPGQIRAL
AAACACPPERRQLAALAEAPAFLDEIVAKRVSALDLLERFPACALPFAVFLDMLPPLRAR
QYSISSSPLRDPARCSLTVAVVDAPASSGSGRYRGVASSFLAEQQPGARVAVAVRPASAH
FRPPADPATPMILICAGTGLAPFRGFLEHRALEAERGQRPARALLYFGCDHPEVDYLYRD
ELRAWQEDGIVDMRPTFALAPEGEDVFVQHRLWRERAEFAALVRAGAHVYVCGDGTRLVP
AVRDTLERMYAAETGATAEATAAWFNDMEHKRGRYAVDAFA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
gtgatcatcaccgcgtcctacgagggccagccgcccgacaacgcgcggcgcttcgtcgcc
gcgctcgacgagctcgcgcccgacagcctcagcgggctgcgctacgcggtctttggctgc
ggcaaccggcagtgggtgcgcacctaccaggcggtgcccaagcgcgtcgatcaggccctg
gcggccgccggcgccacgcccatcagcgaacgcggcgagggcgacgccgacggcgacttc
ttcggcgccttcgagacctggagcgacgtcctgtgggccgcgctcagccgcggcaacggc
gacgcgcgcgccccccgactgcgcgtcgaggtgctgccggccgcgcgcgcgagcgtgctg
cagcagagcaccaccgaactcggacagatcgtcgaaaaccgcgagctggtcgtcatgggc
gcgcccggcgcccgctccaagcggcacatcgagatcgcgctgcccgcgggcacgcgctat
cagcccggcgactacctggccatcctgccgcgcaatccgcccgagcgcatcgagcgcgtc
ctgcgccgtttcggcctggccgaggacacccagatcgtcgtccgcccgggcggcgacaac
gccagccccgccggcgccggcctggcgctgcccagcggctatcccatcgcggccggcgag
ctgctggccggctacctcgagctcggccagccggccacccccggccagatccgcgccctg
gccgcggcctgcgcgtgcccgcccgagcgccgccagctcgcggcgctggccgaggcgccc
gccttcctcgacgagatcgtggccaaacgcgtgagcgcgctcgacctgctcgagcgcttc
cccgcctgcgccctgcccttcgccgtcttcctcgacatgctgccgccgctgcgcgcgcgc
cagtactcgatctcgtcctcgccgctgcgcgaccccgcgcgctgctcgctcaccgtggcc
gtggtcgacgccccggccagctcgggcagcggacgctaccgcggcgtggcctcgtcgttt
ttggccgagcagcagccgggcgcgcgcgtggccgtggccgtgcgaccggccagcgcgcac
tttcgcccgcccgcggaccccgccacgcccatgatcctcatctgcgccggcaccgggctg
gcgccgttccgcggcttcctcgagcatcgcgccctcgaggccgagcgcggccagcgcccg
gcgcgcgcgctgctgtacttcggctgtgaccaccccgaggtcgattacctctaccgcgac
gagctgcgcgcctggcaggaggacgggattgtggacatgcgtccgaccttcgcgctcgcg
cccgagggcgaggatgtgttcgtgcagcaccggctgtggcgcgagcgcgccgagtttgcc
gccctggtccgcgccggcgcccacgtctacgtatgcggcgatggcacgcgcctggtgccc
gcggtgcgcgacaccctcgagcgcatgtacgcggccgagaccggggccacggccgaggcc
acggccgcctggttcaacgacatggagcacaaacgcggccgctacgcggtcgacgccttc
gcctga

DBGET integrated database retrieval system