KEGG   Haliangium ochraceum: Hoch_2671Help
Entry
Hoch_2671         CDS       T01103                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hoh  Haliangium ochraceum
Brite
Enzymes [BR:hoh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Hoch_2671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3681958..3683151
Genome map
AA seq 397 aa AA seqDB search
MLTDRLLHRSLRGQVTTALLPASLLFVLSASGCSKEQEAPPYQAGARPAPTEAEPTAAAT
EQQEPGSAEDAKLLEKARAVFTSPLPTRTDANTPSSEAQIALGRMLYHDTRLSRGHDISC
NSCHSLTDYGVDVREAEGMRQVSLGHKKQKGGRNSPTVYNAGLHLAQFWDGRAADLVEQA
KGPVLNPVEMAMPDEEGVIKVLTSIPGYVSAFQQAFPEDPKPLSYENTARAIAAFEHGLV
TPSRFDEFLGGKTDALTAPEKRGLDAFISTGCTACHMGPAIGGTMYQKLGLLKPYETADM
GRFDATQADADKFFFKVPSLRNIEKTGPYLHDGSLASLEETIQVMAKHQTPSGELDAQTV
ADIVAFLKSLTGDLPMSYIQVPELPESGPDTPGPDLG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtgttgactgatcgtttgctgcatcgctccctgcggggccaggtgaccaccgcgctcctg
cccgccagcctgttgtttgtcctctccgcctcgggatgttcgaaagagcaagaggcgccg
ccgtaccaggcaggcgctcgccccgcccccaccgaggcggagcccaccgccgccgcgacc
gagcagcaagagccggggtcggccgaggacgccaagctcctggagaaggcccgggcggtg
ttcacctcgccgctgccgacgcgcaccgacgccaacacgccctcgagcgaggcccagatc
gcgctcggtcgcatgctgtatcacgacacccgcctgtcgcgcggacacgatatctcctgc
aactcgtgccacagcctcaccgactacggcgtcgacgtgcgcgaagccgagggcatgcgc
caggtgtcgctgggccacaaaaagcaaaagggcggccgcaactcgcccacggtgtacaac
gcgggtctgcacctggcgcagttctgggacgggcgcgcggccgacctggtcgagcaggcc
aaaggcccggtgctcaacccggtcgagatggcgatgcccgacgaggagggcgtgatcaag
gtgctcacctcgatcccgggctacgtgtccgcgttccagcaggccttccccgaagatccc
aagccgctcagctacgagaacacggcccgcgccatcgccgccttcgagcacggcctggtg
acgccctcgcgcttcgacgagttcctcggcggcaagaccgacgcgctcaccgcgcccgag
aagcgcggcctcgacgcgttcatcagcaccggctgcacggcctgccacatgggccccgcg
atcggcggcacgatgtaccagaagctgggtctgctcaagccctacgagaccgcggatatg
ggccgcttcgacgccacgcaggccgatgccgacaagttcttcttcaaggtgccctcgctg
cgcaatatcgagaagaccggcccgtacctgcacgacggctcgctcgcgagcctcgaggag
accattcaggtgatggccaagcaccagacgccgtcgggcgagctcgacgcccagaccgtg
gccgacatcgtcgcgttcctcaagagcctcaccggcgatctgccgatgtcgtatatccag
gtgccggagctgcccgagagcggcccggatacgcccggccccgacctgggctga

DBGET integrated database retrieval system