KEGG   Haliangium ochraceum: Hoch_3452Help
Entry
Hoch_3452         CDS       T01103                                 

Definition
uroporphyrin-III C-methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
hoh  Haliangium ochraceum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Hoch_3452
Enzymes [BR:hoh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Hoch_3452
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Hoch_3452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4765649..4767226
Genome map
AA seq 525 aa AA seqDB search
MRSASSTGVVYLVGAGPGDPGLLTRRGAEVLGRAEVLVYDGLVHTALLELVPSTCTRVYA
GKKHARGRPPLTQDEINAELIAHARAGKRVVRLKGGDPFVFGRGAEECRALREAGLAFEI
VPGVTAATAVPAYAGIPLTARDRTSSVAFATGHEQPGKGDSAIDWQALAKVGTLVLFMAV
RTAAECAQALIAAGRDPQTPAAAVYWGTTARQRTVVAPLVELAQAMDRAALKPPALLVVG
EVVALRPQLDWFEQRPLFGLRVLVPRAEHQAASFAARLRELGAEPVLMPVTRVAAPAEPD
PAWAQVLESSYTWTIFTSANAVEQFFAALRARGRDARFLGGARLACVGRATEAALAAQGL
ICDLLPERGDAAGVAAAVLAASEAAGESVAAQRVLLPRAAEGREEAIAALRAAGCAVQPL
TVYRSETTPSDHPSVEDGVHALRTGAIDAVAFFAPSQVQALLDIAEAAGLTQAEVVERCA
IVAAIGATTQAALEQRGIAVHAAPERPEAALLVEALIAARARPRD
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccgcttcgagcactggcgtggtctatctcgtgggggccggccccggcgacccc
ggtctcctcacccgacgcggcgccgaggtgctgggtcgggccgaggtgctggtctacgac
ggcctggtgcacaccgcgctgctcgagctggtgccgagcacctgcacgcgcgtgtacgcg
ggcaagaagcacgcgcgcggccggccgccgctcacccaggacgagatcaacgccgagctc
atcgcccacgcccgcgccggcaagcgcgtggtccggctcaagggcggcgatccctttgtt
ttcggacgcggcgccgaagagtgtcgcgcgctgcgcgaggccgggctggccttcgagatc
gtgcccggggtgaccgcggccacggccgtgcccgcctacgccggtatcccgctcaccgcg
cgcgatcgcacctcgagcgtggcctttgcaaccggccacgagcagcccggcaaaggcgac
tcggccatcgactggcaggcgctcgccaaggtcggcaccctggtgctgttcatggccgtg
cgcacggccgccgagtgcgcccaggcgctgatcgcggccggtcgcgacccgcagacgccg
gcggccgccgtctactggggcaccacggcgcggcagcgcacggtggtggcgccgctggtc
gagctggctcaggccatggaccgggccgcgctcaagccgccggcgctgctcgtggtcggc
gaggtggtggcgctcaggccgcagctcgactggttcgagcagcgcccgctctttggcctg
cgcgtgctggtgccgcgggccgagcaccaggccgcgtcctttgccgcgcgcctgcgcgag
ctgggcgccgagcccgtgctcatgccggtgacccgcgtggcggcgccggcagagcccgac
ccggcctgggcccaggtgctggagtcgtcgtacacctggacgatcttcaccagcgccaac
gcggtcgagcagttcttcgccgcgctgcgcgcccgcggccgcgacgctcgcttcctcggc
ggcgcgcgtctggcctgcgtgggccgggccaccgaggcggcgctcgcggcccagggcctg
atctgcgatctgctgcccgagcgcggcgacgccgccggtgtggccgccgccgtcctcgcc
gccagcgaggcggcgggcgagtccgttgccgctcagcgcgtgctcttgccgcgcgcggcc
gagggccgggaagaggccatcgcggcgctgcgtgcggccggctgcgcggtgcagccgctc
accgtctaccgcagcgagaccacgcccagcgaccatcccagcgtcgaggacggcgtgcac
gcgctgcgcaccggcgccatcgacgcggtcgccttcttcgcgccctcgcaggtgcaggcg
ctgctcgacatcgccgaggccgccggtctcacccaggccgaggtcgtggagcgctgcgcg
atcgtcgccgcgatcggggcgaccacccaggccgcgctcgagcagcgcggcatcgccgtc
cacgcggcgccggagcgacccgaggccgcgctgctggtcgaggccctcatcgccgctcgc
gcccggccgcgcgactga

DBGET integrated database retrieval system