KEGG   Haliangium ochraceum: Hoch_3456Help
Entry
Hoch_3456         CDS       T01103                                 

Definition
NAD-binding 3-hydroxyacyl-CoA dehydrogenase protein
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
hoh  Haliangium ochraceum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hoch_3456
   01212 Fatty acid metabolism
    Hoch_3456
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Hoch_3456
   00650 Butanoate metabolism
    Hoch_3456
  Lipid metabolism
   00071 Fatty acid degradation
    Hoch_3456
   01040 Biosynthesis of unsaturated fatty acids
    Hoch_3456
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Hoch_3456
   00310 Lysine degradation
    Hoch_3456
   00380 Tryptophan metabolism
    Hoch_3456
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Hoch_3456
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Hoch_3456
   00281 Geraniol degradation
    Hoch_3456
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Hoch_3456
Enzymes [BR:hoh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Hoch_3456
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Hoch_3456
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Hoch_3456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4773779..4776037
Genome map
AA seq 752 aa AA seqDB search
MSDTQAKSVSIRVGDDGVAVVTIDVPGQPVNTLRSELIAEFDAALSALEGDEQVRAAVIV
SGKERGFVAGADIKELERIETAADGEAVSRSAQERFARLAGFRVPVVAAIHGDCLGGGLE
LALACHGRVASDADETSLGLPEVQLGLLPGAGGTQRLPRLIGLQAALDMILTGKRLRAKK
ARALGLVDLVVPAAVLERAARQHALQLAEARAALRKQRAGKGALSRMAATMREAVRGVNL
SGDLQELVLEDNRLGRKVVFDTARKKLLAKTQGNYPAPEKALEAMRLGAAKPEDGYAAEA
RFFGELAVSPEANELIQIFLATTALKKDSGVSGQGAEARPRPVRKVAMLGAGLMGAGIAY
VSAAKAGAQVRLKDRDPASVGRGLRAVREIVDGQLKRKRLSARQRLELMNRVTPTTDYSG
FGDADVIIEAVFEDLALKRRIVAEVEAACGPETIFASNTSTIPIGRIAEASTRPETVIGM
HYFSPVDKMPLLEIIVTEQTAPWVTATCVALGKAQGKTVIVVRDSVGFYTSRILGPYMNE
AFHILAEGVSVERIDRALVDFGFPVGPVKLLDEVGVDVAHKAGTVMREAFGERMDAPPGM
ERLIDDERLGRKNQRGFYLYGGKKKGVDDSVYELLGVAPGRETAADEIAERCALQMVNEA
AHCFGEGVLRSARDGDIGAIFGLGFPPFRGGPLRYVDALGAGVVVERLRALAGRFGKRFE
PAPVLVAMADKKLRFYPDAAGQGSVVEPGRHR
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatacccaagcgaaatccgtttccatccgcgtcggcgatgacggcgtcgccgtg
gtcaccatcgacgtccccggacagccggtcaacaccctgcgcagcgagctcatcgccgag
ttcgacgccgccctgagcgcgctcgagggcgacgagcaggtgcgcgcggccgtcatcgtc
tccggcaaggagcgcggcttcgtcgccggcgccgacatcaaggagctcgagcgcatcgag
accgcggccgacggcgaggcggtgtcgcgcagcgcccaggagcgcttcgcccgcctggcc
gggttccgcgtgcccgtggtcgccgcgatccacggcgactgcctgggcggcggcctcgag
ctggcgctggcctgccacggccgcgtggccagcgacgccgacgagacctcgctgggcctg
cccgaggtgcagctcggcctgttgccgggcgccggcggcacccagcggctgccgcggctc
atcggcctgcaggccgccctcgacatgatcctcacgggcaagcggctgcgggccaagaag
gcgcgcgcgctgggcctggtcgatctcgtggtgcccgccgccgtgctcgagcgcgccgcc
cgccagcacgcgctgcagctcgccgaggcgcgcgcggcgctgcgcaagcagcgcgccggc
aaaggcgccctgagccgcatggcggcgaccatgcgcgaggccgtgcgcggcgtgaacctc
agcggcgacctgcaggagctggtgctcgaggacaatcgtctgggtcgcaaggtggtgttc
gacaccgcgcgcaagaagctgctggccaagacccagggcaactacccggcccccgagaag
gcgctcgaggccatgcgcctcggcgccgccaagcccgaggacggctacgccgccgaggcg
cgcttcttcggcgagctggccgtgagccccgaggccaacgagctcatccagatcttcctg
gccaccaccgcgctcaagaaggacagcggcgtgagcgggcagggcgccgaggcccggccc
cggcctgtgcgcaaggtggccatgctcggcgccgggctcatgggcgccggcatcgcctac
gtcagcgccgccaaggccggcgcccaggtgcggctcaaagaccgcgacccggccagcgtc
ggccgcggcctgcgcgccgtgcgcgagatcgtcgacggccagctcaagcgcaagcggctg
agcgcgcgccagcgcctcgagctgatgaaccgggtgacgccgaccaccgactacagcggc
ttcggcgacgccgacgtgatcatcgaggcggtgttcgaggacctcgcgctcaagcgccgc
atcgtcgccgaggtcgaggccgcctgcggccccgagaccatcttcgcctcgaacacctcg
accatccccatcgggcgcatcgccgaggccagcacccggcccgagaccgtcatcggcatg
cactacttctcgcccgtggacaagatgccgctgctcgagatcatcgtcaccgagcagacc
gcgccctgggtcacggccacctgcgtggccctgggcaaggcgcagggcaagaccgtgatc
gtggtgcgcgacagcgtcggcttctacacctcgcgcatcctgggcccgtacatgaacgag
gccttccacatcctggccgagggcgtctcggtcgagcgcatcgaccgcgccctggtcgat
ttcggcttccccgtcgggccggtcaagctgctcgacgaggtcggcgtagacgtcgcccac
aaggccggcacggtcatgcgcgaggcctttggcgagcgcatggacgcgcctccgggcatg
gagcggctgatcgacgacgagcgcctggggcgcaagaatcagcgcggcttctacctctac
ggcggcaagaagaagggcgtcgacgacagcgtctacgagctgctcggggtcgcgcccggg
cgcgagaccgcggccgacgagatcgccgagcgctgcgccttgcagatggtcaacgaggcc
gcccactgctttggcgagggcgtgctgcgcagcgcgcgcgacggcgacatcggcgcgatc
ttcgggctcggctttccgccgttccgcggcggcccgctgcgctacgtcgacgccctcggc
gccggcgtcgtggtcgagcgcctgcgcgcgctcgccggccgctttggcaagcgcttcgag
cccgcgccggtgctggtcgccatggccgacaagaagctgcgcttctaccccgacgccgcc
ggtcagggcagcgtggtcgagcccggccgccaccgctga

DBGET integrated database retrieval system