KEGG   Haliangium ochraceum: Hoch_3549Help
Entry
Hoch_3549         CDS       T01103                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hoh  Haliangium ochraceum
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Hoch_3549
Enzymes [BR:hoh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Hoch_3549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4886267..4887184
Genome map
AA seq 305 aa AA seqDB search
MSLATIQLREACLDWSRLYVAGVLNVTPDSFSDGGAYLDPEAAVARARALVAAGADIIDI
GGESTRPGAAPVDERSERQRVLPVIEALRAELKVPLSIDTWKSGVAREALAAGAELVNDI
SGGLFDPAIVRVCADAGAVFLLGHVCARPGVADLGAVHAAESAPPSYDEVERALRERVAA
LPDSLRARTIVDPGLGFGKRLPQNLELMRRAGQLGAALGCPIMLGPSRKRFIAELCGDDA
RDMALRDRGTVGACLAAAASGAQLVRVHDVAGLTPALRVFEAARGSLAQGGGDASAAAQT
GRASC
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagcctggcgaccatccagctccgcgaggcatgcttggattggtcgcggctctacgtg
gccggggtcctcaacgtcacgccggattcgttctcggacggcggggcgtatctcgacccc
gaggccgcggtggcgcgcgcgcgtgcgctggtcgcggccggcgccgacatcatcgatatc
ggcggtgagtccacgcgcccgggcgccgcgccggtggacgagcgcagcgagcggcagcgg
gtgctgccggtcatcgaggcgctgcgcgccgagctgaaggtgccgctgtcgatcgacacc
tggaagtccggggtcgcgcgcgaggcgctggcggccggcgccgagctggtcaacgatatc
tccggcggtctcttcgaccccgcgatcgtccgcgtgtgcgcggacgcgggcgccgtcttc
ctcctcggccacgtgtgcgcgcgccccggcgtggccgacctcggcgccgtgcacgcggcc
gagagcgcgccgcccagctacgacgaggtcgagcgcgcgctgcgcgagcgcgtggccgcg
ttgccggactcgctgcgcgcgcgcaccatcgtcgatcccggcctcggcttcggcaagcgg
ctgccgcagaacctcgagcttatgcgccgcgccggacagctcggcgccgcgctcggctgc
ccgatcatgctcgggccctcgcgcaaacgcttcatcgccgagctgtgcggcgacgacgcg
cgcgatatggcgctgcgcgatcgcggcaccgtgggcgcgtgcctggccgcggccgcgagc
ggcgcgcagctcgtgcgcgtgcacgacgtcgccgggctcacgcccgcgctgcgggtgttc
gaagccgcgcgcggatcgctcgcccagggcggcggcgacgcctcggccgcggcgcagacg
gggagggcctcgtgctag

DBGET integrated database retrieval system