KEGG   Haliangium ochraceum: Hoch_3549Help
Entry
Hoch_3549         CDS       T01103                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hoh  Haliangium ochraceum
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hoh00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4886267..4887184
Genome map
AA seq 305 aa AA seqDB search
MSLATIQLREACLDWSRLYVAGVLNVTPDSFSDGGAYLDPEAAVARARALVAAGADIIDI
GGESTRPGAAPVDERSERQRVLPVIEALRAELKVPLSIDTWKSGVAREALAAGAELVNDI
SGGLFDPAIVRVCADAGAVFLLGHVCARPGVADLGAVHAAESAPPSYDEVERALRERVAA
LPDSLRARTIVDPGLGFGKRLPQNLELMRRAGQLGAALGCPIMLGPSRKRFIAELCGDDA
RDMALRDRGTVGACLAAAASGAQLVRVHDVAGLTPALRVFEAARGSLAQGGGDASAAAQT
GRASC
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagcctggcgaccatccagctccgcgaggcatgcttggattggtcgcggctctacgtg
gccggggtcctcaacgtcacgccggattcgttctcggacggcggggcgtatctcgacccc
gaggccgcggtggcgcgcgcgcgtgcgctggtcgcggccggcgccgacatcatcgatatc
ggcggtgagtccacgcgcccgggcgccgcgccggtggacgagcgcagcgagcggcagcgg
gtgctgccggtcatcgaggcgctgcgcgccgagctgaaggtgccgctgtcgatcgacacc
tggaagtccggggtcgcgcgcgaggcgctggcggccggcgccgagctggtcaacgatatc
tccggcggtctcttcgaccccgcgatcgtccgcgtgtgcgcggacgcgggcgccgtcttc
ctcctcggccacgtgtgcgcgcgccccggcgtggccgacctcggcgccgtgcacgcggcc
gagagcgcgccgcccagctacgacgaggtcgagcgcgcgctgcgcgagcgcgtggccgcg
ttgccggactcgctgcgcgcgcgcaccatcgtcgatcccggcctcggcttcggcaagcgg
ctgccgcagaacctcgagcttatgcgccgcgccggacagctcggcgccgcgctcggctgc
ccgatcatgctcgggccctcgcgcaaacgcttcatcgccgagctgtgcggcgacgacgcg
cgcgatatggcgctgcgcgatcgcggcaccgtgggcgcgtgcctggccgcggccgcgagc
ggcgcgcagctcgtgcgcgtgcacgacgtcgccgggctcacgcccgcgctgcgggtgttc
gaagccgcgcgcggatcgctcgcccagggcggcggcgacgcctcggccgcggcgcagacg
gggagggcctcgtgctag

DBGET integrated database retrieval system