KEGG   Haliangium ochraceum: Hoch_3582Help
Entry
Hoch_3582         CDS       T01103                                 

Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hoh  Haliangium ochraceum
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hoh01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:hoh00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4935629..4936420
Genome map
AA seq 263 aa AA seqDB search
MSILARILERKRDELADAKRLRPFAALADQAASAPPTRGFASALRRPDGAPVRVIAEIKR
ASPSAGPIRPGADPADIGAMYQAAGAAAISVLTDESFFDGHLDFLARVRAVTEVPLLRKD
FLIDPYQVVEARAAGADAVLLIVAALEHELLAQLLAEARTYGLDALVEVHDADEAERAVA
AGAEIIGVNHRNLRTFEVDTGLTAQLRPLLPKDAIAVGESGVRSAADVRRLGEAGADAVL
VGERLMRESHPGEALAALMGIGA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatcctggcccgcatcctcgagcgcaaacgcgacgagctggccgacgccaagcgc
ctgcggccgttcgcggcgctcgccgaccaggccgcgagcgcgccgcccacgcgcgggttt
gccagcgcgctgcggcgccccgatggcgccccggtgcgcgtcatcgccgagatcaagcgg
gcctcgccctcggccggccccatccgccccggcgccgaccccgcggacatcggcgccatg
taccaggccgccggcgccgccgccatctcggtgctcaccgacgagtccttcttcgacgga
cacctcgactttctcgcccgcgtgcgcgcggtcaccgaggtgccgctgctgcgcaaggac
ttcctcatcgacccctaccaggtggtcgaagcccgcgccgccggcgccgacgccgtgctg
ctgatcgtcgccgcgctcgagcacgagctcttggcccagctcctggccgaggcccgcacc
tacggactcgacgccctggtcgaggtccacgacgccgacgaggccgagcgcgcggtcgct
gccggcgccgagatcatcggcgtcaaccaccgcaacctgcgcaccttcgaggtcgatacc
ggcctcaccgcgcagctccgtccgctgctgcccaaagacgccatcgcggtcggcgagagc
ggcgtgcgctcggccgccgatgtgcgccgcctgggcgaggccggcgccgatgccgtgctc
gtgggcgaacgcctgatgcgcgagtcccatcccggcgaggcgctcgccgcgctgatgggc
atcggcgcatga

DBGET integrated database retrieval system