KEGG   Haliangium ochraceum: Hoch_3815Help
Entry
Hoch_3815         CDS       T01103                                 

Definition
(GenBank) Phosphodiesterase/alkaline phosphatase D-like protein
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
hoh  Haliangium ochraceum
Pathway
hoh00790  Folate biosynthesis
hoh01100  Metabolic pathways
hoh02020  Two-component system
Module
hoh_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Hoch_3815
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Hoch_3815
Enzymes [BR:hoh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Hoch_3815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N
Motif
Other DBs
NCBI-ProteinID: ACY16315
UniProt: D0LZ53
Position
complement(5242372..5244285)
Genome map
AA seq 637 aa AA seqDB search
MKCALGAVCACTADSDCVSGFCECADAACAERTCQATACDCSYGADCAAPVNDGARDPNS
CEEGAACHGGLCLTPTPEPEPPTEPELIDTVSVVVRTEDSTSQQVSVCLSETDCYVLDRS
DVPDLAQPGVTETFHFENLALPRERVDRLELRMPSIPAGTNDWGAACVAVQFDGVPAYCQ
EPIPAVLGDNSGSVPSWRDPEGLHVSCSSCYADTLTYGPMIGAVEAHRARIWLRTDAARQ
VGLRLSGSRELDSAPVVAWSQPEATSDFATVLVAENLEPNTVYYYGVEIDGVLHTDPDWW
FTTTREKGEPGVLRMAYGSCARRNHPQQIFNPLAAMRPELFLFVGDNHYGDSATLDGQRW
NYQDMRATPRRLLQARTPTLAIWDDHDFLGNDTDGTDSRRSVARRAFMEYWANPGYGGED
GGIYFTHSVGDVDFFMLDGRYFRDPVTGDAVYGDGEGRSSLLGPTQTVWFLDALRASTAT
FKVIAIGSQWTRHGNDDSWATHMEARDAIFDVIEESRIEGVILLSGDRHRSEYRKLPRPG
AYDLPEFTSSPLANTVRECDLDDDDLLVCHQENYQVSFMTIDTLSDEPSITSTIYEYINN
ELIPVEGGEVRYTLSDLSFPVAASEDDSAATSAPAKR
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatgcgcgctcggggcggtgtgtgcgtgcaccgccgactccgattgcgtatcgggc
ttctgcgagtgcgcggacgcggcgtgtgccgagcggacctgccaggcgacggcctgcgac
tgcagctacggcgcggattgcgctgcgccggtgaacgatggcgcgcgcgatcccaactcg
tgcgaggagggcgccgcgtgtcacggcggcctgtgcctcacgccgacgccggagcccgag
ccgccgactgagcccgagctgatcgacaccgtctcggtcgtggtgcgcacagaggactcg
accagccagcaggtttccgtctgtctgtccgaaaccgactgctatgtgctcgaccgcagc
gacgtccccgacctggcgcagccgggcgtgaccgagaccttccacttcgagaatctggcg
ctgccgcgcgagcgcgtcgaccgtctcgagctgcggatgccgtcgattcccgccggcacc
aacgactggggcgccgcgtgcgtggccgtgcagttcgacggcgtgcccgcctactgccag
gagccgatcccggcggtgctgggcgacaacagcggctcggtgccgtcgtggcgcgatccc
gaggggctgcacgtgtcgtgctcgagctgctacgccgacacgctcacctacgggcccatg
atcggcgcggtcgaggcgcatcgcgcgcgcatctggctgcgcaccgacgccgcccggcag
gtcggtctgcggctctcgggcagccgtgagctcgacagcgccccggtggtggcgtggtcg
cagcccgaggcgaccagcgacttcgccaccgtactcgtggccgagaatctcgagccgaac
acggtctactactacggcgtcgagatcgacggcgtgctgcacaccgatcccgactggtgg
ttcacgacgacgcgcgagaagggcgagcccggcgtgctgcgcatggcctacggctcgtgc
gcgcggcgcaaccatccccagcagatcttcaaccccttggccgccatgcgccccgagctg
ttcctgttcgtcggcgacaaccactacggcgactccgccaccctcgacggccagcgctgg
aactaccaggacatgcgcgcgacgccgcggcgcctgctgcaggcgcgcacgccgaccctg
gcgatctgggacgatcacgacttcctcggcaacgacaccgacggcaccgactcgcgccgc
agcgtagcccggcgcgcgttcatggagtactgggccaaccccggctacggcggcgaggac
ggcggcatctacttcacccacagcgtcggcgacgtggacttcttcatgctcgacgggcgc
tatttccgcgacccggtcaccggagacgcggtgtacggcgacggcgagggccgcagcagc
ctgctcgggccgacgcagacggtgtggttcctcgacgcgctgcgggcttcgaccgcgacc
ttcaaggtcatcgccatcggcagccagtggacccggcatggcaatgacgactcgtgggcc
acgcatatggaggcccgcgacgccatcttcgacgtcatcgaggagagccgcatcgagggc
gtgatcctgctctcgggcgatcgtcaccgctccgagtaccgcaagctgccgcggccgggc
gcctacgatctgcccgagttcacctcgtcgccgctggccaataccgtgcgcgaatgcgac
ctggacgacgatgacctgctggtctgccaccaggagaactaccaggtctcgttcatgacc
atcgacacgctctcggacgagccgtcgatcaccagcacgatctacgagtacatcaacaac
gagctgattccggtcgagggcggcgaggtgcgctacacgctctcggacctgagcttcccg
gtcgcggcgagcgaggacgacagcgcggcgacgtctgcgcccgcgaagcgctga

DBGET integrated database retrieval system