KEGG   Haliangium ochraceum: Hoch_3924Help
Entry
Hoch_3924         CDS       T01103                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hoh  Haliangium ochraceum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Hoch_3924
Enzymes [BR:hoh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Hoch_3924
Exosome [BR:hoh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Hoch_3924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5409168..5410157)
Genome map
AA seq 329 aa AA seqDB search
MSSYPHTRMRRNRASDWSRRLVRENALSTDDLIWPVFVCEGDSTRERVGSMPGVERLSID
LLTEAAAEAKELGIPALALFPVTPADKKTPDGEEAKNPDNLVCRAVRAVKQQVPGIGIIC
DVALDPYTTTGQDGLVRDGFVVNDETVEVLCEQAVVQAQAGCDVIAPSDMMDGRIGAIRD
ALDAEDLDQVQILAYSAKYASAFYGPFRDAVGSSGALGTGDKRTYQMDPANGDEAEREVA
QDLEEGADMVMVKPGMPYLDIVFRVKHTFSVPTFVYQVSGEYAMLRGAAEQGWLDWDKVL
LESLLAFKRAGADAVLTYGALDAARLLRR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtccagctatccccatacccgtatgcggcgcaatcgcgcgagcgactggagccgccgc
ctggtgcgcgagaacgcgctgagcaccgatgacctcatctggccggtgttcgtgtgcgag
ggcgacagcacgcgcgagcgcgtgggctcgatgcccggcgtcgagcgcctgtccatcgat
ctcctcaccgaggccgcggccgaggccaaggagctcggcatcccggcgctggcgctgttc
ccggtgacgcctgcggacaagaagacgcccgacggcgaagaggccaagaacccggacaac
ctggtgtgccgcgcggtccgcgccgtcaagcagcaggtgcccggcatcggcatcatctgc
gatgtcgccctcgacccgtacacgaccacgggccaggacgggctggtgcgcgacggcttc
gtggtcaacgacgagaccgtcgaggtgctgtgcgagcaggcggtggtccaggcccaggcc
ggctgcgacgtcatcgcgccttcggacatgatggacggccgcatcggcgccatccgcgac
gcgctcgacgccgaggatctcgaccaggtgcagatcctggcctactcggccaagtacgcg
tcggcgttctacggtcccttccgcgacgcggtgggctcgagcggcgcgctcggcaccggc
gacaagcgcacctaccagatggatccggccaacggcgacgaggccgagcgcgaggtcgcc
caggatctggaagagggcgccgatatggtcatggtcaagcccggcatgccgtacctcgac
atcgtgttccgggtgaaacacaccttctcggtgccgaccttcgtgtaccaggtgagcggc
gagtacgcgatgctgcgcggcgcggccgagcagggctggctcgactgggacaaggtgctg
ctcgagagcctgctggccttcaagcgcgcgggcgccgacgccgtgctcacctacggcgcg
ctcgacgcggcccgcctgctgcggaggtag

DBGET integrated database retrieval system