KEGG   Haliangium ochraceum: Hoch_4273Help
Entry
Hoch_4273         CDS       T01103                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
hoh  Haliangium ochraceum
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hoch_4273
  Amino acid metabolism
   00340 Histidine metabolism
    Hoch_4273
Enzymes [BR:hoh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Hoch_4273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5862696..5864012
Genome map
AA seq 438 aa AA seqDB search
MILKRIPLDAGGDSRELRALLERSTSFASEVERAVADILAEVRARGDEAVRAFTEKFDGR
SPRAGSSYEIPPGDWRRAKGELAPEVLAALEQAAERVRAFHARQAEVDRAADFSLDGGGM
RLDLRIDPLSRVGIYVPGGTARYPSSVLMTAIPARIAGVDEIIMVTPGASKETLAAAALA
GVDRVFEIGGAQAVAALAYGTESVPRVDKIVGPGNQWVAAAKRQVFGVVDIDSVAGPSEV
LILADDSANPRWVAADLLAQAEHDPLAHPVLATTSPALADAVDEELARQLADLPRADIAR
TALANQGAAVLVPDQGAAVAFANRYAPEHLELHLREPRAVLGQLRTAGAIFVGALAAEAA
GDYMAGPNHVLPTGGAARYASPLGVYDFRKHTSIIEYQAEAVLAQADAIAALAAVEGLDA
HGRSMTLRRDALRAADDD
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcaaacgcattcccctcgacgccggcggcgacagccgcgaactgcgcgccctg
ctcgagcgctcgacctccttcgccagcgaggtcgagcgcgcggtggccgacatcctcgcc
gaggtgcgcgcccgcggcgacgaagccgtgcgcgccttcaccgagaaattcgacggccgc
tcgccgcgtgcgggcagcagctacgagattccgcccggcgactggcgccgcgccaagggc
gagctggcccccgaggtgctcgccgcgctcgagcaggccgccgagcgggtgcgcgccttc
cacgcccgccaggccgaggtcgaccgcgcggccgatttctcgctcgacggcggcggcatg
cgcctcgacctgcgcatcgacccgctgtcccgggtcggcatctacgtgcccggcggcacc
gcgcggtatccctcctccgtgctcatgaccgccatcccggcgcgcatcgccggcgtcgac
gagatcatcatggtcaccccgggcgcctccaaggagaccctggcggccgccgccctggcc
ggcgtcgaccgggtgttcgaaatcggcggcgcgcaggccgtggccgcgctcgcctacggc
accgagagcgtgccccgggtggacaagatcgtcggccccggcaaccagtgggtggccgcc
gccaagcgccaggtcttcggcgtggtcgacatcgactcggtggccggcccctccgaggtc
ctgatcctggccgatgacagcgccaacccgcgctgggtcgccgccgacctgctggcccag
gccgagcacgaccccctcgcccacccggtgctggcgaccacctcgccggcgctggccgac
gcggtcgacgaagagctcgcgcgccagctcgccgatctgccgcgcgccgacatcgcccgc
accgcgctcgccaaccagggcgccgccgtgctggtgcccgaccagggcgccgccgtggcc
tttgccaaccgctacgcgcccgaacacctcgagctgcacctgcgcgagccccgcgcggtg
ctcggccagctccgcaccgccggcgccatcttcgtcggcgcgctcgccgccgaggccgcc
ggcgactacatggccgggcccaatcacgtgctgcccaccggcggcgccgcgcgctacgcc
tcaccgctcggcgtctacgacttccgcaagcacacctcgatcatcgagtaccaggccgag
gccgtgctcgcgcaggccgacgccatcgccgccctggccgcggtcgagggcctcgacgcc
cacggccgctccatgaccctgcgccgcgacgccctgcgcgccgccgacgacgactga

DBGET integrated database retrieval system