KEGG   Haliangium ochraceum: Hoch_4995Help
Entry
Hoch_4995         CDS       T01103                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hoh  Haliangium ochraceum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hoch_4995
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hoch_4995
  Amino acid metabolism
   00310 Lysine degradation
    Hoch_4995
Enzymes [BR:hoh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Hoch_4995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6889881..6891131
Genome map
AA seq 416 aa AA seqDB search
MTVEIKVPSAGESITEVFIGTWLKNEGDSVTKDETLVEVETDKATMEVPAPVSGTLVNVL
KKSGDSASVGEVIAHIEEGEVSADAGAASKSADKADTGDKGDKAADGSSEGEPRVMPAAQ
RLLDENGLDAGAVEATGPGGRLLKEDVLRHLESAGASAKAKGDAGTSARPASEGKASANG
GGGGREEEVVAMSPLRRTIARRLVEAQQNAALLTTFNEVDMSAVMALRAEHKERFEKRYG
VRLGFMSFFVKAAVDALKQFPQINAEVREQSIVYKNYYDIAVAVSGPKGLVTPVLRNTER
MSFADVEKTIGDFGQRAQKNKLTPDELRGGTFTISNGGVFGSLLSTPIINPPQSGVLGMH
AIQERPVAIDGQVVIRPMMYLALSYDHRIVDGREAVTFLKRIKEAVESPARMLLEI
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcgaaatcaaagtgccctccgcgggcgaatcgatcaccgaagtctttatcggg
acgtggctcaagaacgagggcgacagcgtcaccaaggacgagaccctggtcgaagtcgag
accgacaaggccacgatggaagtgcccgcgccggtgagcggcacgctggtcaacgtgctc
aagaagagcggcgacagcgcctcggtcggcgaggtcatcgcccatatcgaagagggcgaa
gtgagcgccgacgcgggcgccgcgagcaagagcgccgacaaggccgataccggcgacaag
ggtgacaaggccgcggacggctcgtccgagggcgagccgcgcgtgatgccggcggcccag
cgcctgctcgacgagaacggcctcgacgccggcgcggtggaggccaccggcccgggcggt
cgcctgctcaaagaggacgtgctgcgccacctcgagtcggccggcgcgagtgccaaggcc
aagggcgacgccggcaccagcgcgcgcccggccagcgagggcaaggcgagcgcgaacggc
ggcggcggcggtcgcgaggaagaggtcgtggccatgagcccgctgcgccggaccatcgcc
cggcgcctggtcgaggcgcagcagaacgcggccctgctcaccaccttcaacgaggtcgac
atgagcgcggtgatggcgctgcgcgccgagcacaaggagcgcttcgagaagcgctacggg
gtgcgtctcggcttcatgagcttcttcgtcaaggccgcggtcgacgcgctcaagcagttc
ccgcagatcaacgccgaggtccgcgagcagtcgatcgtctacaagaactactacgacatc
gcggtggcggtctcgggtcccaagggtctggtcacgccggtgctgcgcaacaccgagcgc
atgagcttcgccgatgtcgagaagaccatcggcgatttcggacagcgcgcccagaagaac
aagctcacgcccgacgagctgcgcggcggcaccttcaccatctccaacggcggcgtcttc
ggcagcctgctgtccacgcccatcatcaacccgccgcagtccggcgtgctcggcatgcac
gccatccaggagcggccggtagcgatcgatggccaggtcgtcatccgcccgatgatgtac
ctggcgctcagctacgaccaccgcatcgtcgatggacgcgaagccgtcaccttcctcaag
cgcatcaaagaagcggtcgagtcgcccgcgcgcatgctgctcgagatctga

DBGET integrated database retrieval system