KEGG   Haliangium ochraceum: Hoch_4995Help
Entry
Hoch_4995         CDS       T01103                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hoh  Haliangium ochraceum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hoch_4995
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hoch_4995
  Amino acid metabolism
   00310 Lysine degradation
    Hoch_4995
Enzymes [BR:hoh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Hoch_4995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6889881..6891131
Genome map
AA seq 416 aa AA seqDB search
MTVEIKVPSAGESITEVFIGTWLKNEGDSVTKDETLVEVETDKATMEVPAPVSGTLVNVL
KKSGDSASVGEVIAHIEEGEVSADAGAASKSADKADTGDKGDKAADGSSEGEPRVMPAAQ
RLLDENGLDAGAVEATGPGGRLLKEDVLRHLESAGASAKAKGDAGTSARPASEGKASANG
GGGGREEEVVAMSPLRRTIARRLVEAQQNAALLTTFNEVDMSAVMALRAEHKERFEKRYG
VRLGFMSFFVKAAVDALKQFPQINAEVREQSIVYKNYYDIAVAVSGPKGLVTPVLRNTER
MSFADVEKTIGDFGQRAQKNKLTPDELRGGTFTISNGGVFGSLLSTPIINPPQSGVLGMH
AIQERPVAIDGQVVIRPMMYLALSYDHRIVDGREAVTFLKRIKEAVESPARMLLEI
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcgaaatcaaagtgccctccgcgggcgaatcgatcaccgaagtctttatcggg
acgtggctcaagaacgagggcgacagcgtcaccaaggacgagaccctggtcgaagtcgag
accgacaaggccacgatggaagtgcccgcgccggtgagcggcacgctggtcaacgtgctc
aagaagagcggcgacagcgcctcggtcggcgaggtcatcgcccatatcgaagagggcgaa
gtgagcgccgacgcgggcgccgcgagcaagagcgccgacaaggccgataccggcgacaag
ggtgacaaggccgcggacggctcgtccgagggcgagccgcgcgtgatgccggcggcccag
cgcctgctcgacgagaacggcctcgacgccggcgcggtggaggccaccggcccgggcggt
cgcctgctcaaagaggacgtgctgcgccacctcgagtcggccggcgcgagtgccaaggcc
aagggcgacgccggcaccagcgcgcgcccggccagcgagggcaaggcgagcgcgaacggc
ggcggcggcggtcgcgaggaagaggtcgtggccatgagcccgctgcgccggaccatcgcc
cggcgcctggtcgaggcgcagcagaacgcggccctgctcaccaccttcaacgaggtcgac
atgagcgcggtgatggcgctgcgcgccgagcacaaggagcgcttcgagaagcgctacggg
gtgcgtctcggcttcatgagcttcttcgtcaaggccgcggtcgacgcgctcaagcagttc
ccgcagatcaacgccgaggtccgcgagcagtcgatcgtctacaagaactactacgacatc
gcggtggcggtctcgggtcccaagggtctggtcacgccggtgctgcgcaacaccgagcgc
atgagcttcgccgatgtcgagaagaccatcggcgatttcggacagcgcgcccagaagaac
aagctcacgcccgacgagctgcgcggcggcaccttcaccatctccaacggcggcgtcttc
ggcagcctgctgtccacgcccatcatcaacccgccgcagtccggcgtgctcggcatgcac
gccatccaggagcggccggtagcgatcgatggccaggtcgtcatccgcccgatgatgtac
ctggcgctcagctacgaccaccgcatcgtcgatggacgcgaagccgtcaccttcctcaag
cgcatcaaagaagcggtcgagtcgcccgcgcgcatgctgctcgagatctga

DBGET integrated database retrieval system