KEGG   Haliangium ochraceum: Hoch_5037Help
Entry
Hoch_5037         CDS       T01103                                 

Definition
(GenBank) glucose-methanol-choline oxidoreductase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
hoh  Haliangium ochraceum
Pathway
hoh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Hoch_5037
Enzymes [BR:hoh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Hoch_5037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C GMC_oxred_N DAO FAD_binding_2 NAD_binding_8 Pyr_redox_2 FAD_binding_3 Thi4 Lycopene_cycl Pyr_redox HI0933_like Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ACY17525
UniProt: D0LVG4
Position
complement(6948798..6950516)
Genome map
AA seq 572 aa AA seqDB search
MRDKQFDAVIVGSGFGGAVMAYRLAEAGLRVCVLERGKKYPPGSFPRTPAALSRATWDPD
AGKQGLFDIWSFRTMDAVTASGLGGGSLVYSNVLLRKDERWFVTEGTTPGVFEHWPVNRA
DLDPHYDAVEKVLRPKPYPFAQEPYADTPKTHAMRDAAAAVRDCEWFLPPLTVNFAPSDK
RPGVPFEGPPDMHGEPRSTCRLCGECNIGCNYGSKDSLDFNYLSMAQRAGAELLTRAEVL
SFEPAGAYGYRVNYVEHTPALEGRPYRRSDLPTHTIRAKRLILAAGALGSTALLLRMRRD
REAFGKLSRMLGHRFSGNGDLLTMALHCCDRDDHRGPRRIDASFGPVITSAIRVTDALDS
PTRPPHDTVHERGLYIEDAGFPAFLAWVLESAPVPSTIGRALGFAHRYLAGHLGFNSDTN
LSAELSEFIGDARLTETSLPFLCMGRDVASGVMHVDAGDNLDLHWSMDDSAEYIDRVRQM
TQRLADALGGYHADNPLWRLRRFITVHPLGGCPMGRHAGEGVVDSWGHVFGYPGLYVADG
ATMPGPVGANPSLTIAAMADRCADGILRELGR
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgacaagcagttcgacgctgtaatcgtgggttcggggtttggcggcgcggtgatg
gcttatcgactggccgaggccgggctgcgggtgtgtgtgctcgagcgtggcaagaagtat
ccgccgggttcgtttccgcgcacgccggcggcgctgagccgcgccacctgggacccggac
gcgggcaaacagggcctcttcgatatctggtccttccgcaccatggacgcggtcacggcc
agcggtctgggcggcggctcattggtctactccaacgtgctgctgcgcaaggacgagcgc
tggttcgtgaccgagggcaccacgcccggcgtgttcgagcactggcccgtgaaccgcgcc
gacctcgacccgcactacgacgcggtcgagaaggtgctgcgccccaagccctatcccttt
gcgcaagagccctacgcggacacacccaagacccacgcgatgcgcgacgcggccgcggcc
gtgcgcgactgcgagtggttcctgccgccgctcacggtcaacttcgcgccttcggacaag
cgtccgggtgtgcccttcgagggcccgcccgatatgcacggcgagccgcgctcgacctgc
cggctgtgcggcgaatgcaatatcggctgcaactacggcagcaaggactcgctcgacttc
aactacctgtcgatggcgcaacgcgcgggcgccgagctgctcacccgcgccgaggtgctg
tccttcgaacccgccggcgcctacggctaccgggtcaactacgtcgagcacacgcccgcg
ctcgagggccgtccgtaccggcgctcggatctgccgacgcataccatccgcgccaaacgc
ctgatcctggccgccggtgccctgggcagcacggcgctgcttctgcgcatgcgccgcgac
agggaggcatttggcaaactcagccgcatgctcggccaccgcttcagcggcaacggcgac
ctgctgaccatggccctgcactgctgcgaccgcgacgaccaccgcgggccgcggcgcatc
gacgccagcttcgggccggtgatcaccagcgccatccgcgtcaccgatgccctcgattcc
cccacgcggccgccccacgacacggtccacgagcgcggcctgtacatcgaagacgccggc
tttcccgcgttcttggcctgggtgctggagagcgcgccggtgcccagcaccatcggccgc
gcgctcgggttcgcgcaccgctacttggccggacacctgggcttcaactccgataccaac
ctcagcgccgagctgtccgaattcatcggcgatgcccgcctcaccgagacctcgctgccg
tttctgtgcatgggccgcgatgtcgccagcggggtcatgcacgtcgacgcgggcgacaat
ctcgacctgcactggagcatggacgactcggccgaatacatcgatcgcgtgcgccagatg
acccagcgcctggccgacgcgctcggcggctaccacgccgataatccgctgtggcggctg
cgccgcttcatcaccgtgcacccgctgggcggctgccccatgggccgccacgcaggcgag
ggcgtggtcgatagctggggccacgtgttcggctaccccggcctgtacgtggccgacggc
gccaccatgccgggcccggtgggcgccaatccctcgctcaccatcgccgcgatggccgac
cgctgcgccgacggcatcctgcgcgaactgggccgctga

DBGET integrated database retrieval system